SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000013528 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000013528
Domain Number 1 Region: 4-150
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.73e-18
Family SPRY domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000013528   Gene: ENSMODG00000010799   Transcript: ENSMODT00000013775
Sequence length 172
Comment pep:novel chromosome:BROADO5:4:318311379:318341643:1 gene:ENSMODG00000010799 transcript:ENSMODT00000013775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAVQLDTQHMGTDVVIVKNGRRICGTGGCLANAPLHQNKSYFEFKIQSTGIWGIGVATQ
KVNLNQIPLGRDVHSLVMRNDGALYHNNEEKNRLPANNLPQEGDVVGITYDHVELNVYLN
GKNMHCPASGIRGTVYPVVYVDDSAILDCQFSDFYHIPPTGFEKILFEQQIF
Download sequence
Identical sequences F7C0C6
ENSMODP00000013528 ENSMODP00000013528 13616.ENSMODP00000013528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]