SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000014714 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000014714
Domain Number 1 Region: 317-569
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.4e-109
Family STAT DNA-binding domain 0.000000000464
Further Details:      
 
Domain Number 2 Region: 134-317
Classification Level Classification E-value
Superfamily STAT 8.83e-61
Family STAT 0.000000116
Further Details:      
 
Domain Number 3 Region: 1-120
Classification Level Classification E-value
Superfamily Transcription factor STAT-4 N-domain 3.14e-44
Family Transcription factor STAT-4 N-domain 0.0000187
Further Details:      
 
Domain Number 4 Region: 570-708
Classification Level Classification E-value
Superfamily SH2 domain 7.54e-43
Family SH2 domain 0.000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000014714   Gene: ENSMODG00000011747   Transcript: ENSMODT00000014986
Sequence length 750
Comment pep:novel chromosome:BROADO5:4:208199290:208254156:-1 gene:ENSMODG00000011747 transcript:ENSMODT00000014986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAPWLEKQDWDHAAIDVSFATVCFHEL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIISNCLKEERKILAAAQ
QFDQAHMGNIQNAVMPGKQKEIGLQVKNVKDRVMDIEQEIKVLEDLQDERDFKIKTLSNR
EHDHFGTATNEHKQEKMLIQKMYLMLDQKRKEVVQKIIELLNATELIQNVLLNEELVEWK
QRQQSACIGGPPNACLDQLQNWFTIVAESLQQARQQLKKLEELEQKYTYDLDPIPKNKDI
LRDRTLSLFKQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLTTE
PKNLSFFLNPPCAKWSQLSEVLSWQFSSVTKRGLNLEQLNMLGEKLLGPNSSTTDGLIPW
TRFCKENINDKNFSFWLWIEGVLELIKKHLISLWNDGCIMGFISKEQERALLKDQLPGTF
LLRFSESSRDGAITFTWVEGTQNDPVFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIPE
NPLKFLYPNIDKDHAFGKYYSRPKEAPEPMEVDGPKGTGYIKTELISVSEVHPSRLQSTE
NLLPMSPEDFDEFSRIVGHVELNNVMNATL
Download sequence
Identical sequences F7DFB0
ENSMODP00000014714 XP_007494594.1.35504 ENSMODP00000014714

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]