SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000015660 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000015660
Domain Number 1 Region: 316-360
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000293
Family Laminin-type module 0.051
Further Details:      
 
Domain Number 2 Region: 414-472
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000486
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 3 Region: 470-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000093
Family Laminin-type module 0.016
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000015660
Domain Number - Region: 517-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000707
Family EGF-type module 0.026
Further Details:      
 
Domain Number - Region: 54-71,111-194
Classification Level Classification E-value
Superfamily Sialidases 0.00157
Family Sialidases (neuraminidases) 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000015660   Gene: ENSMODG00000012511   Transcript: ENSMODT00000015950
Sequence length 588
Comment pep:novel chromosome:BROADO5:1:459109122:459210431:1 gene:ENSMODG00000012511 transcript:ENSMODT00000015950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSPSFTPNPDAAFPGPLQARSSPPPPAVMLLLASLLLHCLPLAMGDYDICKSWVTTDEG
PSWEFYACQPKAMSMKDYVMVKVEPAGITCGDPPERFCTHENPYLCSDECDASNPDLAHP
PRLMFDKEDEGLATYWQSVTWSRYPSPLEANITLSWNKSIELTDDIVMTFEYGRPTIMML
EKSLDNGRTWHPYQYYAEDCMEAFNMPPRRVRDLSSTSANRVVCTEEYSRWAGSKKEKHV
RFEVRDRFAIFAGPDLRNLDNLYTRLESAKGLKEFFTATDLRMKLLRPALGGTYVQRENL
YKYFYAISNIEVIGRCKCNLHANLCSYKEGGLQCECEHNTTGQDCGKCKKNFRTRSWRAG
SYLPLPNGSPNACAAAGSAFGTATTVAVPAKISKLFQLKPKSPQVVPIEVFKDCECYGHS
NRCSYIDFLNVVTCVSCKHNTRGQHCQHCRLGYYRNGSAELDDENVCIECNCNQIGSIND
RCNETGHCECREGAAGPKCDDCLPSHYWRQGCFPNVCDDEYLLCQNGGTCYQNQRCLCPS
GYQGVLCDQPLCQGEEGQACNPAPHAGPHLAVFLGSGLLLWLAGCLGY
Download sequence
Identical sequences F6Q0S1
XP_003339683.2.35504 ENSMODP00000015660 ENSMODP00000015660

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]