SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000016595 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000016595
Domain Number 1 Region: 243-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000954
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 2 Region: 185-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000856
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 3 Region: 161-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000873
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 4 Region: 327-354
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000191
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000016595
Domain Number - Region: 117-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0205
Family Classic zinc finger, C2H2 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000016595   Gene: ENSMODG00000013267   Transcript: ENSMODT00000016900
Sequence length 395
Comment pep:novel chromosome:BROADO5:4:230827352:230833481:-1 gene:ENSMODG00000013267 transcript:ENSMODT00000016900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPTKVPRREALVLQCEWGSCTFVASAVEEFCEHVTQHLQQHLQGPEEEDEDEYSCLWQEC
GFCSPDSSADLVRHVYFHCYHTKLKQWGLQALQGQAGLSHCLLDFQSRNMIPDIPDHFLC
QWEHCESSFDNPEWFYRHVEAHSLCCEYKAASKENHVVPCGWKDCNCTFKGRCKLREHLR
SHTQEKVVACPTCGGMFANNTKFFDHIRRQTSLDQQRFQCSHCSKRFATERLLRDHMRNH
VNHYKCPLCDMTCPLPSSLRNHIRFRHSEDRPFKCDYCDYSCKNLIDLRKHKDTHSKEPA
YHCEFESCNFSDWDSNSFDFTCQGDSEPRYKCHVCDKCFTRGNNLTVHLRKKHQFKWPSG
HPRFRYKEHEDGYMRLQLVRYESVELTEQLLRERE
Download sequence
Identical sequences F7D9I7
ENSMODP00000016595 ENSMODP00000016595 13616.ENSMODP00000016595

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]