SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018342 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018342
Domain Number 1 Region: 57-523
Classification Level Classification E-value
Superfamily Cytochrome P450 4.32e-115
Family Cytochrome P450 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018342   Gene: ENSMODG00000014425   Transcript: ENSMODT00000018675
Sequence length 540
Comment pep:novel chromosome:BROADO5:3:478188427:478274527:1 gene:ENSMODG00000014425 transcript:ENSMODT00000018675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPESKWLSHQLGLLGLEPKVSSALLLIFLAFSTWILGKGLICIHQFRTNCQWLRCFPEP
PEWHWLNGHAGVIKPSEEGIKRVLQFVAAFREVFVMWGGPFFPIVFICHPDYIKPLLSAS
ANIAPKDKLFYGFFEPWLGDGLLLSSGDKWSRHRRLLTPAFHFDILKPYVKFFNQSTDIM
HMKWRHLCVGDNVRLNIFEHISLMTLDSLQKCVFSHDSHCQEKPSSYISAILELSALVSR
RNNQPLLYWNSLYYLTSQGRHFSRACNAVHVFTDDVIQNRRRVLAEQGSEAFLRNKRKGK
TLDFIDVLLLAKDEDGKALSDEDIRAEADTFMFEGHDTTASGLSWALYNLSQHQEYQDRC
RQEIQELLKGRQLEEIEWDDLSQMPFLTMCIKESLRLHPPVVAIARRCTKDIKLPDGRII
PKGNTCLVSIFGTHHNPTVWPNPEVYDPNRFDPNNTQISPLAFLPFSAGPRNCIGQNFAM
AELKVALALTLLRFRILPDEHPPRRKPEVILRSEDGLWLRVEPLQHPSTLEIHTPETSQD
Download sequence
Identical sequences F7E7M6
ENSMODP00000018342 XP_007489767.1.35504 XP_007489768.1.35504 ENSMODP00000018342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]