SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018630 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018630
Domain Number 1 Region: 144-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000299
Family EGF-type module 0.0063
Further Details:      
 
Domain Number 2 Region: 115-150
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000407
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018630   Gene: ENSMODG00000014898   Transcript: ENSMODT00000018966
Sequence length 295
Comment pep:novel chromosome:BROADO5:2:268394164:268398404:1 gene:ENSMODG00000014898 transcript:ENSMODT00000018966 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRDRVLLCSLLVGFSVLMLLGGQRLNGDLPFSKGVCSRQTLVVPLRYNESYSQPIYKP
YLTLCAGRRVCSTYRTTYRVAWREVRREVQQIHAICCQGWRKKHPGALTCEEAICAKPCQ
NGGICMQPDQCDCTPGWGGKHCHVDVDECRTGITLCSHSCSNTLGSFICSCPKGLALGSD
GRTCEEIHPEPLPSPSILSLTVREAEKEEHSLRQEIGELRGRLEVLEQWAGHASAWVRAM
LPVSPEAIRPEQVAELWGRGDRIDSLSDQVLLLEEKLGACSCEDNSLGPGLNSRR
Download sequence
Identical sequences F7G6J1
ENSMODP00000018630 ENSMODP00000018630 XP_001376525.1.35504 XP_007483667.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]