SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018657 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018657
Domain Number 1 Region: 82-267,365-402
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-59
Family Calnexin/calreticulin 0.0001
Further Details:      
 
Domain Number 2 Region: 239-369
Classification Level Classification E-value
Superfamily P-domain of calnexin/calreticulin 5.1e-27
Family P-domain of calnexin/calreticulin 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018657   Gene: ENSMODG00000014922   Transcript: ENSMODT00000018994
Sequence length 449
Comment pep:novel chromosome:BROADO5:3:479801761:479836677:-1 gene:ENSMODG00000014922 transcript:ENSMODT00000018994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHHPVGGRSAQAQPVCKALRGLKFLSTSRNTAGSISGAPDRANQKAPPDRGREKKTHLRA
AMSRAKVPGPLWALWLMRAALATVYFQEEFLDGESWRNRWIPSTNDSKFGHFRLSSGKFY
GDIQKDKGLQTTENAKFYAISSRFKPFSNKGKTLVIQYTVKHEQKMDCGGGYIKIFPSEL
DQKNLNGKSQYYIMFGPDICGFDIKKVHVILFYKNQYHSNKKPIRCKVDGFTHLYTLTLR
PDLTYEVKIDTDIIESGSIEEDWNLQKIRRMEKSALKMPENWDKLSQNDKPSDDWDKHLL
DASANKPSDWNSELDGEWQPSVIQKPKHKDGLKLDNSDYKDVWLHKKIENPGYLQDFEFL
EYEDIGVIGLELWQVRSGTIFDNFLITDDENYAADFGLKTWGRTKDPEKEMDMIQAKEEI
KKAREEEEQLIRENIKEKYFQSQTAKDEL
Download sequence
Identical sequences F7FVR7
ENSMODP00000018657 ENSMODP00000018657

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]