SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018908 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000018908
Domain Number 1 Region: 613-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.38e-24
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 2 Region: 669-726
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.23e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 54-145
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 3.71e-23
Family SCAN domain 0.00027
Further Details:      
 
Domain Number 4 Region: 557-614
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.43e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 5 Region: 176-236
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.67e-23
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 6 Region: 501-558
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.3e-23
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 7 Region: 445-502
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 8 Region: 715-767
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-18
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 392-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.83e-17
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018908   Gene: ENSMODG00000015127   Transcript: ENSMODT00000019249
Sequence length 770
Comment pep:novel chromosome:BROADO5:3:463420677:463430247:1 gene:ENSMODG00000015127 transcript:ENSMODT00000019249 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTIAEGRDARETASLNEAMTTFPSPQIMPLCKQGKVPSAEDLKEQETSRGRDSLDPAVS
HQNLRWFQRPEVASPQEEELNQIRELCMQWMDPETRAKEDVLDMLVLDQYVIILPREVMT
WVKSQPSEHSEEVEILLEDLSQMFEDNVLTSPDSDVSQDQSSTEEGATSRPLPDQAQDSV
TFKDVAVMFSRKEWWHLQPTQMELYRDVMLENYRNMVSVGLLTSKPELIAQLERGEAPWM
RSRTVSRGPGAGSETRFVTKEAALKQGIYMKGSSQERLLRDGPYASTLGEAWKCEDSQLE
KQKDNQEGQSRKVTKEQEKTSKGTRPRCNIFRKYFRPGSGLVTKKKVPLATNLHKYTKQK
LSLKQYLDLVRSKLAEPENKSTYKARPKTRSYCSNLFKAQRIPPGKKGYKCKACGKTFIY
NSSLTRHLRIHTGEKPYKCYECKKSFRRRSFFNLHKRVHTGEKPYKCNECDKAFIRDSSL
FKHQIIHSGKKPFKCNECKKAFTLRGLLIEHQRIHTGEKPFTCDVCKKAFSHKSSLIQHQ
RIHTGERIFKCNTCEKTFNQSTRLTEHKRIHTGEKPYKCNKCEKAFTQRTHLNEHQRVHT
GEKPYKCSHCEKAFSNSSSLTQHLRIHTGEKPYKCNQCEKAFSQNSSLIIHLRFHSGETP
FKCKDCGKAFSRNSSLTRHQKTHSGEKPFKCDECGKAFGRNSSLTDHQKIHTGKKPYKCG
DCGIAFNQHTRLIEHQRIHTGEKPHQCDLCKKAFRSSSAVLRHQRIHSGE
Download sequence
Identical sequences F7DJG4
XP_007489629.1.35504 ENSMODP00000018908 ENSMODP00000018908

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]