SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000018999 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000018999
Domain Number - Region: 249-328
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0837
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000018999   Gene: ENSMODG00000015207   Transcript: ENSMODT00000019341
Sequence length 915
Comment pep:novel chromosome:BROADO5:7:171756246:171818071:-1 gene:ENSMODG00000015207 transcript:ENSMODT00000019341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLPWNAISNSLTRERNLMNINHKDSESITDVCSNEDLPEVELVSLLEEQLPQYKLRVDS
LFLYENQDWTQSPHQNQHDSDAISPVLAEETFRYMILGTDRVEQMTKTYNDIDMVTHLLA
ERDRDLELAARIGQALLKRNHVLSEQNETLEEQLGQAFDQVNQLQHELSKKDELLRIVSI
ASEESETDSSCSTPLKFNESFSLSQGLLQLDMLQEKLKELEEENLALRSKACDIKTETIT
YEEKEQQLVNDCVKELRETNAQMSRMTEELSGKSDELIRYQEEISSLLSQIVDLQHKLKE
HVIEKEELRLHLQASKDAQRQLTMELHELQDRNAECLGMLHESQEEVKELRSRSSPAAHV
YGPQQCGAFSAESLAAEIEGTMRKELSLDEESSLCKQKVQQKRVFDTVKVANDARCRSAS
FPALLPIPGSNRSSVIMTAMPFQSDLQHMESSKHLNPKSSMDDTSKDSLKIELPGTPGVN
DLATALHRLWLRRHNYLSEKQFFAEEWERKMHVLAGEKEEASGYSTPTGSFASLCTNQSE
VTDLSTSTSCIRAFMPEKLQIVKPLEGSQTLHHWQQLAQPNLGTILDPRPGVITKGFTVL
PEDAIYHLSDLEEDEDGGITFQVQQPFQEEGKPSMSKPVPSIFLPPITSTSVPLTASNPG
KCLSSTNSTFTFTTCRILHPSDITQVTPSSKFPSLSCGSTSSSTPSTAMNSPALSYRLSM
GESVTSRRDSTTTCSSTMSLAKLLQERGISAKVYHSPISENPLILPAIKVPAIPSTPPNS
PSRSPCSSPLPFEPRAQISENFLASRPAETFLQEMYGLRPSKTPPDIGQLKMNLVDRLKR
LGIARVIKTPEMKENGKSQQGTEIGLRRPDSAAFLNASSNLLGGLRRNQSLPVMMGSFGA
PVCTSSPKMAILKED
Download sequence
Identical sequences F7B9T0
XP_003341889.1.35504 XP_007501674.1.35504 ENSMODP00000018999 ENSMODP00000018999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]