SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000019852 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000019852
Domain Number 1 Region: 49-173
Classification Level Classification E-value
Superfamily Stathmin 5.75e-54
Family Stathmin 0.00000038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000019852   Gene: ENSMODG00000015911   Transcript: ENSMODT00000020207
Sequence length 176
Comment pep:novel chromosome:BROADO5:1:504668931:504676230:1 gene:ENSMODG00000015911 transcript:ENSMODT00000020207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYDADTVALNWCVISDMEVIELNKCTS
GQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKHLAEKR
EHEREVIQKAIEENNNFIKMAKEKLTQKMESNKENREAHLAAMLERLQEKEPPAAR
Download sequence
Identical sequences F6ZRY0
ENSMODP00000019852 XP_001370641.2.35504 XP_020839393.1.61212 ENSMODP00000019852

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]