SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020324 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020324
Domain Number 1 Region: 31-462
Classification Level Classification E-value
Superfamily Cytochrome P450 9.43e-62
Family Cytochrome P450 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020324   Gene: ENSMODG00000016255   Transcript: ENSMODT00000020681
Sequence length 463
Comment pep:novel chromosome:BROADO5:7:193047974:193124330:-1 gene:ENSMODG00000016255 transcript:ENSMODT00000020681 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDFAIFAVTFLLVLVGAVLYLYPASRQASGIPGITPTEEKDGNLPDIVNSGSLHEFLVN
LHERYGPVVSFWFGRRLVVSLGTMDALRQHINPNRTSHPFETMLKSLLRYQSGLDGDAVE
NHIRKKLYENGVNKSLQSNFAFMVKLSEELLGKWLSYPESQHVPLCQHMLGYAMKAVTQI
AMGNSFEDDQKVIHFQKNHNTVWSEIGKGFLDGSLDKSTTRKKQYEEALMEIETVFKKVI
KERRGRNFSQHIFIDSLLQGNLNEKQILEDSMIFSLAGCVITANLCMWAVYFLTTSEDVQ
KKLHKELDQVLGKGPITQEKIDQLRYCRQVLCETVRTAKLTPIAAKLQDLEGKVDQHIIP
RETLVLYALGVVLQDHCAWPSPYKFDPDRFNDESAMKNLSLLGFSGTQECPELRFAYMVA
TVLLSVLVRKLYLHPLEGQVIETKYELVTSSKEEAWITVSKRN
Download sequence
Identical sequences F7C1X6
XP_001366710.1.35504 ENSMODP00000020324 13616.ENSMODP00000020324 ENSMODP00000020324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]