SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000020444 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000020444
Domain Number 1 Region: 536-567,648-722
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000251
Family Anti-sigma factor antagonist SpoIIaa 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000020444   Gene: ENSMODG00000016353   Transcript: ENSMODT00000020804
Sequence length 777
Comment pep:novel chromosome:BROADO5:8:159517389:159577470:1 gene:ENSMODG00000016353 transcript:ENSMODT00000020804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASGRLDSELPEYRNYVVSRPVYNEPSFLEQYERQLRERKTVREKLVKCCSCSRRRLIG
ILKSLFPILEWLPKYRVKEWLLSDTISGVSTGLVATLQGMAYALLAAVPVGYGLYSAFFP
ILTYFIFGTSKHISVGPFPVVSLMVGSVVLSMAPDEQFILPSINGTVDNDTQIDFGARDA
ERVLIASTLTVLVGIIQLVLGGLQIGFIVRYLADPLVGGFTTAAAFQVFVSQLKIVLNIS
TKNYNGVLSIIYTLVEIFEKIGTTNMADFIAGLLTIVICMVVKEINDRFKHKIPIPIPIE
VIVTIIATAISYGVDLEKKYNAGIVKSIPRGFLPPELPSVNLFSQMATASFSIAVVAYAI
AVSVGKVYATKYDYAIDGNQEFVAFGISNIFSGFFSCFVATTALSRTAVQESTGGKTQVA
GIISALIVLIAIVALGKLLEPLQKSVLAAVVIANLKGMFMQVCDVPRLWRQNKIDAVIWV
FTCIASIILGLDLGLLAGLLFGLLTVVLRVQFPSWNDLGNVPGTDLYKSTKDYKNVDEPE
GVKIVSFYSPIFYGNIDGFKKCLKSTVGFDAVRVYNKRLKALRKIQKLIKKGQLRATKNG
IVSDACATNQGFEPDEDPEDPEDLDIPTKEVEIRVDWNSELPVKVNVPKVPIHSLILDFG
AVSFLDVVAVRSLRMIVKEFHRIDVNVYFASLKDHVIAKLEQCAFYEDNIVKDMFFLTVH
DAVLYIQSQIKNETVQDPILEKINLMQEYKDPLEIMDREVNEGGLDVQDEAMRRLAS
Download sequence
Identical sequences F7F6U5
13616.ENSMODP00000020444 ENSMODP00000020444 ENSMODP00000020444 XP_001363598.1.35504 XP_007504180.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]