SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000021521 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000021521
Domain Number 1 Region: 537-568,648-708
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00000000000155
Family Anti-sigma factor antagonist SpoIIaa 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000021521   Gene: ENSMODG00000017245   Transcript: ENSMODT00000021897
Sequence length 754
Comment pep:novel chromosome:BROADO5:8:154441254:154499827:-1 gene:ENSMODG00000017245 transcript:ENSMODT00000021897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNNFQDTMDHTQENEILIATQTYCVERPIYSYPALHGKLHKKDKVSDPIGDKIKRALSCT
PKKIRNIIYMFLPICKWLPAYKPREYVFGDFVSGISTGVLHLPQGLAFAMLAAVPPVFGL
YSSFYPVILYCFFGTSRHVSIGPFAVISLMIGGVAVRLVPDDMYVGGGGANSTNGTEERD
AMRVKVAMSVTLLSGIIQFCLGVLRFGFVAIYLTEPLVRGFTTAAAVHVFTSMLKYLFGV
KTKRHSGPFSVVYSTLAVIANVKKLNICSLVVGLMCFALLLGGKEFNERFKNKLPAPIPL
EIVAVIIGTGISAGFNLEESYKVDVVGSLPLGLLAPATPDSSLFHLVYVDAIAIAIVGFS
VTISMAKIFAVKHGYQVDGNQELIALGICNSIGSLFQTFSISCSLSRSLVQESTGGNTQL
AGCLASLLILLVILAIGFLFESLPQAVLSAIVIVNLKGMFMQFSDLPFFWRTSKIELTIW
LTTFVSSLFLGLDYGLITAVIIALMTVIYRTQSPTYTVLGQLPNTDVYIDIDAYEEVKEH
AGIKIFQINAPIYYANSDLYNNALRRKTGVNPALIMAARRKALKKHAKELGTQGKPKSSV
VKVDEDAETGGEEEAKQEEQNEENAKPMTIDSLVQKTFPAELERFLPPGPNVHTMILDFS
QVNFIDSVGVKTVSGILKEYGDVGIYVYLAACSAQVVNDLTRNRFFENPCVKELLFHSIH
DAVLGAKVREALAQQEALAPPPEEDSEPIADPEE
Download sequence
Identical sequences F6TKX6
XP_007504130.1.35504 ENSMODP00000021521 ENSMODP00000021521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]