SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000022272 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000022272
Domain Number 1 Region: 422-464
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000005
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number 2 Region: 371-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000166
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000022272   Gene: ENSMODG00000017867   Transcript: ENSMODT00000022661
Sequence length 627
Comment pep:novel chromosome:BROADO5:8:99188033:99222476:-1 gene:ENSMODG00000017867 transcript:ENSMODT00000022661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLGELGFGRELNWSAGVGDLGCNEKYKPFPSLLFHPPCVAQALEHATTIRTLCARALGD
ATPGPTSCSAAAASGAVSASALAWAIGREGEREGGGAMAAAITDMADLEELSRLSPLPSG
SPNPATRTRAEPSGGEEEEEEEEEEAEAQAVAELLLNGDGGGGGGSSGGGGGGGGGGEAE
TMSEPSPESASQAGEDEDEEEEEEEDESSSSSGGGEEESSAESLVGSGSSSDETRSLSPG
AASSSSGDGDGKEGLEEPKGPRGGQGSCGGGGSGGGGGGAGGGGSSSSSVVSSAGDEGYG
TGGGGSSATSVGRRGSLEVSSDGEPLSRMDSEDSISSTIMDIDSTISSGRSTPAMMNGQG
STTSSSKNIAYNCCWDQCQTCFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPST
SQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVASQPKAKEE
SPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVF
HSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDP
NIYRTMPQKRLKRTLIRKVFNLFLSKQ
Download sequence
Identical sequences F6YI89
ENSMODP00000022272 XP_007503618.1.35504 ENSMODP00000022272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]