SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023467 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023467
Domain Number 1 Region: 362-462
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.33e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0015
Further Details:      
 
Domain Number 2 Region: 173-227,254-269,297-315
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000013
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 91-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023467   Gene: ENSMODG00000018814   Transcript: ENSMODT00000023883
Sequence length 789
Comment pep:novel chromosome:BROADO5:2:495986162:496043319:-1 gene:ENSMODG00000018814 transcript:ENSMODT00000023883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATAANPEMASDVSSLSAAIVSGNPGPGVQGGGAITQRTIKRRPGLDFDDDGEGNSKFL
RCDDDQMPNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGNSSVDPGSMNRLSFVRNRCRNGLGSVKEGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEASQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNTEGIFTFVDHRCIATVGYQPQELLGKDIVEFCHHEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNHEWLWMRTSSFTFQNPYSDEIEYIICTNTSVKNSNQEQRPTLSNSIQ
RPQLGPAANLPLEMGSGQLAPRQQQQTELDVVTGREGLASYNHSQVSVQPGTATGPEHSK
SLEKSDGLFGQDRDPRFAEIYPNISADQNKGITSSTVPASQQLFSQGNTFPPVPRSTENF
RNSSLVPPGTIVQPPASAGQMLAQISRHSNPPQGTAPAWNPSTRPGFVAQQVAPPPASKT
RSPQFAVSNFQTPSSFSPMSLAGTPSASSGAAAYPSLTSRASSFATETGQPSGQFQARTA
EGVSVWPQWPQGQQTHHRSGSGDQHVQPPPQQPSQPEVFQEMLSMLGDQGNTYNNEEFPD
LTIFPSFSE
Download sequence
Identical sequences F6YZC2
XP_007485450.1.35504 ENSMODP00000023467 ENSMODP00000023467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]