SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023572 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023572
Domain Number 1 Region: 25-492
Classification Level Classification E-value
Superfamily Cytochrome P450 6.59e-64
Family Cytochrome P450 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023572   Gene: ENSMODG00000018894   Transcript: ENSMODT00000023991
Sequence length 493
Comment pep:novel chromosome:BROADO5:2:292483967:292578659:-1 gene:ENSMODG00000018894 transcript:ENSMODT00000023991 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEIFLTALFIILGFTAFYLFHQRRDPQNPPCISGWIPWIGAGFKFGEAPLEFIEQARIKY
GPVFTVFALGNRITFVTEEEGIDVFFKSKDINFEHSVQELIEKIVSVPKDIFFSFHGILY
GLMKNKMRISHLYQFTEKMVEELHEQLETLGTDGKNDLFNLVRNSLYPVTVNFVFGKGLY
PITHKKIVEFHEHFQNFDEGLQFASQMPECFIRNWSKSKKWFLTLFEKSIPDLEKYKPSD
DDSLTIMQLITNALRQGTSEHKAPNYALLMLWASLSNLATRGVLSSIKTGYFSPIKEKEK
SNSLVACWTIMFILHNPSVYKNVMEGIVSVFGEAGKNNIKISEKDLKKLPLIKWCVLETI
RLVSPGIITRKVMEPMKILSYTIPAGDILMLSPFWIHRNPKYFPEPELFKPERWEKADLE
KNASLDCFVAFGGGKYPCPGRWFVLLEIEIFVALLFYKYQLHLVDPFPKQSLKQLMGVQR
PVTSCRVEYKCRK
Download sequence
Identical sequences F7CQT2
ENSMODP00000023572 ENSMODP00000023572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]