SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023868 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023868
Domain Number 1 Region: 34-189
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.4e-29
Family Calponin-homology domain, CH-domain 0.0033
Further Details:      
 
Domain Number 2 Region: 214-290
Classification Level Classification E-value
Superfamily GAS2 domain-like 2.62e-26
Family GAS2 domain 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023868   Gene: ENSMODG00000019125   Transcript: ENSMODT00000024292
Sequence length 905
Comment pep:novel chromosome:BROADO5:2:499174541:499184870:1 gene:ENSMODG00000019125 transcript:ENSMODT00000024292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGGSLVTSPSRFQPSGKTMSRLPDPPIRSIRPFKSSEQYLEAMKEDLADWLRNLYELDI
DSANFLEMLETGHLLCQHANAVTQAAQDFLAQSPALAKRILLPSSGVCCNGTAQPGTFQA
RDNVSNFIQWCRKEMGIKEVLMFETEDLVLRKNEKHVILCLLELGRRAWRFGVAAPTLVH
LEEEIEEELRQELALPPPDPPPPSPPARKACHFKNLDQMVQNLVSHCTCPVQFSMVKVSE
GKYQVGDSNTLIFVRILRNHVMVRVGGGWDTLSHYLDKHDPCRCTSLSHKMGHPQKPHIP
PVQHEVRVQGGSTQPQPILTISRSQSPLPPVAWKTYTPPGRKLRPPTSCSPKPHNRWGAG
VESPGETAAIQRSRERPATPSYLLSTAGHGDSKSQSSLTRIPSCQPSPAGDASQKPQSSV
TQTGQDLHRVPLRQWKDRCSPEASRGGTPPRWSQGSGVTDSTLQKVSDPEVAPKEPPGRV
TSTLPCSSNLSKSFTFKQPLLGTEKPSQDQAKGAIASHLKDNGSVQSSSPIKEATKIPIC
SSPSCPLTPEKNPSESGNRISGPATETGRDSTTIRVRAGGRNTPQSQNGSQSQEVSSGGQ
DQALRTVTEAGRDHSPRHQHGRQTFTTLPIDKTKEQALYQNLEEEILTNIKILEARGAHP
GVTPCPIEPPEMHVPRSDVYIPHRWPVPGASYDSVIRELALEPPALLKVDMSGWGTPDMH
TPELDTPLSKRDSEEKVSLDEDERRKRKTGIGVRNTKALGEQGGQSRAPLPEVNGNDVPQ
PVDTSDLEKPKTTTGKGRRMLKKPERIPSIYKLKLKSKIRPRRDHRPEKRPSRIPTPLAY
RQSQAKVPPTTPKLRGRLGSAGDGGSVDEEEISPSEVSIGPSTESLGSRPAGPSWLPQED
EESWV
Download sequence
Identical sequences F7EV42
XP_001373480.2.35504 ENSMODP00000023868 ENSMODP00000023868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]