SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000023962 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000023962
Domain Number 1 Region: 126-170
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000642
Family EGF-type module 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000023962   Gene: ENSMODG00000019194   Transcript: ENSMODT00000024386
Sequence length 237
Comment pep:novel chromosome:BROADO5:5:21864200:21874879:1 gene:ENSMODG00000019194 transcript:ENSMODT00000024386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAPLQPPPPLTPSPVLLSLLVLSAVCHHVAASDTNDTYPERKDLFSGDHSTDGVELPSG
SEMSSGTEYDYSGEYEEDPQLSGYFIDDSIRVGRLVKPKKNRTESEKNSDKTRRKKNRGK
KRKPKKKVNPCDAKYQSYCIHGECKYIESLEAVTCKCHQDYFGERCVEQSMKTHSLGDGG
RFGTALAIVAGLLSVLCFSAIVVIIVQIRKVHSNVHDLEAEERRHLRQENGNGSIRV
Download sequence
Identical sequences F7A8Y1
13616.ENSMODP00000023962 ENSMODP00000023962 ENSMODP00000023962 XP_007495739.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]