SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000024227 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000024227
Domain Number 1 Region: 335-437
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.4e-27
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0032
Further Details:      
 
Domain Number 2 Region: 64-147
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000262
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 3 Region: 146-200,227-242,270-282
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000154
Family BphP N-terminal domain-like 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000024227   Gene: ENSMODG00000019416   Transcript: ENSMODT00000024656
Sequence length 716
Comment pep:novel chromosome:BROADO5:1:118189716:118451316:-1 gene:ENSMODG00000019416 transcript:ENSMODT00000024656 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATPAAVNPSEMASDIPGSVSLPVAPMATGQVRMAGAMPARGGKRRSGMDFDDEDGEGPS
KFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTGN
KSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFGS
TLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRM
RCGNAPLDHLPLNRITTMRKRYRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEEDA
DVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPAEFLSRHNSEGIITFVDPRCISVIGYQ
PQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTFQ
NPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNIPANVHETGKPVE
KADTIFSQERDPRFAEMFAGITASEKKMMASASAPGNQQLYSQGSPFQPGHSGKAFSSSV
VHVPGVNDIQSSSSTGQNMTQISRQINQSQVAWTGSRPPFPGQQIPTQSSKTQSSPFGIG
TSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTSGFAESGQSSGQFQGRPSEVWSQWQ
NQHHNQQSSDQHSHQQPNQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
Download sequence
Identical sequences F6SYF3
ENSMODP00000024227 ENSMODP00000024227 XP_001367955.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]