SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025223 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025223
Domain Number 1 Region: 374-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000937
Family Classic zinc finger, C2H2 0.041
Further Details:      
 
Domain Number 2 Region: 332-361
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000135
Family Classic zinc finger, C2H2 0.0084
Further Details:      
 
Domain Number 3 Region: 416-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000258
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025223   Gene: ENSMODG00000020173   Transcript: ENSMODT00000025672
Sequence length 591
Comment pep:novel chromosome:BROADO5:5:293697472:293733265:1 gene:ENSMODG00000020173 transcript:ENSMODT00000025672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGGTEEPRPPEQQQQQQPEPEPEPEVERQRPEQEGAEAAAAEAAPEQEQQQEEQQQPPP
PATAAAGGATGSRVLRGGRERGRAAAAAAAAAAAAAASRRRKAEYPRRRRSSPSARTGVA
TELTPAKKSSRLSCTEKIVATSKDPKEEKEEEDNSTLAQEAPIAASRPSRGWRSSSRTAA
SRHCDTENTRSSRSKTGSLQLICKSEPNTEELEYEITEEQQSPGGGVSSDEEEEEEEMLI
SEEEIPFKDDPRDETYKPHLEREAPKPRRKSGKVKEEKEKKEIKVEVEVEIKEEENEIRE
DEEPPRKRGRRRKDDKSPRLPKRRKKPPIQYVRCEMEGCGTVLAHPRYLQHHIKYQHMLK
KKYVCPHPSCGRLFRLQKQLLRHAKHHTDQRDYICEYCARAFKSSHNLAVHRMIHTGEKP
LQCEICGFTCRQKASLNWHMKKHDADSFYQFSCNICGKKFEKKDSVVAHKAKSHPEVLIA
EALAANAGALITSTDILGTNPESLAQSTDAQGLPLLPEPLGNSAPAECLLLDSEGMPKAF
CSGAERVSLMADGKIFVGSGSSGGTEGLVMNTEILGATTEVLIEDSDSTEP
Download sequence
Identical sequences F7GI32
XP_001377530.2.35504 ENSMODP00000025223 ENSMODP00000025223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]