SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000025242 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000025242
Domain Number 1 Region: 632-970
Classification Level Classification E-value
Superfamily RNI-like 1.81e-73
Family 28-residue LRR 0.0000419
Further Details:      
 
Domain Number 2 Region: 2-91
Classification Level Classification E-value
Superfamily DEATH domain 1.41e-25
Family Pyrin domain, PYD 0.0014
Further Details:      
 
Domain Number 3 Region: 1000-1098
Classification Level Classification E-value
Superfamily RNI-like 1.49e-21
Family 28-residue LRR 0.0031
Further Details:      
 
Domain Number 4 Region: 223-401
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000000000000127
Family Nucleotide and nucleoside kinases 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000025242   Gene: ENSMODG00000008879   Transcript: ENSMODT00000025691
Sequence length 1125
Comment pep:novel chromosome:BROADO5:4:349852250:349900104:-1 gene:ENSMODG00000008879 transcript:ENSMODT00000025691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTESVRCILVRYLEELTFEELKKFKLFLEDSPPKEKFLRIPRSQMKKADNTDMAELMVHH
YGEGEAWDVALMIWEKMGLRELWEQAKREAPQMEKLRWNSRFLKGKDKKSERRKLGFWKH
VDKLMKKWSGQDHMDQWNEGCQTTYRNRIMEKFRVMRDRNSCPGEYENLHHRFTRLLLLQ
EYRHREQKEHELLAIGWEHAEIMENQGQLIEVASLFDPDKKREAHPQVVVLQGAAGIGKT
TLARKVILDWAEGNLYQDKFDYVFYLHCREMNHLREKKIRFADLIANDWPFLEASMKRIL
SHPEKLLFVIDGLDELKFSCDEHSYDLCKDWNLQQPVPILLSSLLRKTMLLESSLLITTR
LTALEKCDFLFENPRHVEILGFSEEDRWKYFCKFFGDEDQAQQAFSLIVNNETLFTMCFV
PLMCWIICTCMKQQMRRKKDLKQASKTTTTLYMCYLSSLATPGARSCSVQHHRSLCRMAA
EGIWEGKILFDGDDLRRHGLEASDVSAFLDMHIFQKDSDSENCYSFIHLSFQEFFAAMFY
ALGEEKETGGRAVPPIPGVKDLLAKCRDSATSFVALTVHFLFGFLNADNRKRLEEIYDCK
ISQEIKLELLQWIQAVTEQQHKDPSLRNDLLEMFSHLYETQDEEFVTTAMAHFQEISLNI
YSKLHFLISVFCIKFCHNLGKIRLNIARFQMKSLQFKVFQLAVVDWQHLFSVLSKNQNLR
TLDLSGTELANSAVNALCSELSQSSCKLQKLSLSKCQLTASCCQHLSSLLKNNKNLTYLD
LSMNFLGDEGIKALCEVLRNQNCNIQELNLSRCRFSDACCKNLSSALMAHGNINILDLSE
NTLADVGMNLLCEALGSSDCNLQELKLSQCHFTDACCQDLSTCIKNQSLIHLDVSGNFLQ
DSGIRLLCEALRHPTCNLQKLLLSLCHITDSSCQDVSFALKNNRSLIHLDLGCNNLYNHG
VKLLCEALENQNCNLQTLELWNCQLSAACCHEFSSVLKKNQSLTHLNLGANPLRNNGVKV
LCEALGNQNCKLQKLKLCKCLLSAVGCRYLSTALKSNQNLTHLKLTGNGLGDDGVKLLFE
ALKNSDCKLQKLTLDKWKLSADTQRIQDELRQRKPHLIIENSSLC
Download sequence
Identical sequences F7GHL5
ENSMODP00000025242 ENSMODP00000025242 XP_007491160.1.35504 XP_007491161.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]