SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027197 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027197
Domain Number 1 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-24
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 2 Region: 231-288
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.13e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-20
Family KRAB domain (Kruppel-associated box) 0.0019
Further Details:      
 
Domain Number 4 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.46e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 512-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.49e-20
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 6 Region: 343-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.53e-20
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 7 Region: 194-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.14e-19
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 473-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-17
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 287-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.31e-17
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 10 Region: 107-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000354
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027197   Gene: ENSMODG00000000806   Transcript: ENSMODT00000028722
Sequence length 610
Comment pep:novel chromosome:BROADO5:Un:40522645:40533203:-1 gene:ENSMODG00000000806 transcript:ENSMODT00000028722 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPKLPTSGHQESLTFRDVAVLFTWDEWRRLGPAQRSLYREVMLETFEHLVALGLPGFRS
DVISRLERALWMGRGPGSFPDEIPETKVPGPNQGISEGPSSKERLQEQGTPSRDKPNKWN
ECGKAFSQNALFMCHERVLSGEKPCKIKECGKAFCPLGSPNDYKRMYSQKKLHISNESRK
IFTLHPRVPSAKEPFYCNECGKAFRWRCKLNTHQRIHTGEKPFECKECGRAFRDKSYLLL
HQRIHTGEKPFECSECGKNFSLKSSLILHQKIHTGKKLFECNECRKAFHYKSCLTLHQRI
HTREKPFECNEYGKAFMWKTQLNKHKRIHIVEKPFESDNCIKTFSLKGILTEHQRIPMEE
KRFECNECDKAFRWRCKLTAHQRIHTGEKPFECRECRKTFREKSCLTLHQRIHTGEQPFE
CDECRKNFSQRSSLISHQRIHTGEKPYECNECGKSFMWKSQFNKQKNIANGKKSFECNVC
RKIFHDKSHFTVHQRIHTGEKPFECVECGKNFSQRSSLISHQRNHITKKLFECNECRKAF
CDKSHLTVHQRIHTGEKPFEYKECGKTFSQSSSLSSHQRIHSGEKPFECNECGKAFRDKS
HLTVHQRIHT
Download sequence
Identical sequences H9H8R8
ENSMODP00000027197 ENSMODP00000027197

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]