SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027313 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027313
Domain Number 1 Region: 368-425
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.49e-27
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 480-537
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.91e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 172-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-25
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 536-593
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.65e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 6 Region: 424-481
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 592-649
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 8 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 9 Region: 638-690
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.52e-21
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 11 Region: 119-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000553
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 219-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000149
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027313   Gene: ENSMODG00000022795   Transcript: ENSMODT00000028855
Sequence length 692
Comment pep:novel chromosome:BROADO5:Un:24748100:24759126:-1 gene:ENSMODG00000022795 transcript:ENSMODT00000028855 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVTFQDVAVDFTREEWCLLSPPQKELYREVMLENVRNLLSVGLPAPPKDVLSYLEQRDAP
RMLEQESLRSCHPGDVWSIGEEWENPTEVSLPVEEMDLQRFMSDGPNNFTSRKFCVGPQN
SSHIEHQRMHPEEKSSESNQCRKTFMYRASLARHQRIHSLKKPYECNQCGKTFSQSSSLA
LHQRIHTGEKPYECNQCGKSFTGNSSLVVHKRIHTREKPYECNQCGKKFSQTSSLAVHQR
IHTGENLYECNQCGKSFTGNSFLAVHQRIHTGEKPYECNQCGKTFSQSSSLAVHQRIHTG
EKPYECIQCGKAFSQSSSLAVHQRIHTGENLCECNQCGKTFSRSAYLAVHQRMHTGEKPY
ECNQCGKTFSQSSSLAIHQRIHTGEKPYECNQCGKAFSMSSNLAYHQRTHTGEKPYECNQ
CGKAFSMSSHLAVHQRMHTGEKPYECNQCGKTFSRSDYLAVHHRMHTGEKPYECNQCGKA
FSMSSHLAVHQRMHTGEKPYECNQCGKTFSRSDYLAVHQRMHTGEKPYECNQCGKSFTAY
SSLVLHQRMHTGEKPYECQQCGKAFSQSSHLVDHQRTHTGEKPYECKLCGKTFRQSFNLV
LHQRIHTGEKPYECIQCGKAFSQSSSLAVHQRTHTEEKPYKCKQCGKPFASNSSLAVHQR
IHTGEKPYECKQCGKAFTNNSNLAVHQRIHTG
Download sequence
Identical sequences H9H933
ENSMODP00000027313 ENSMODP00000027313

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]