SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000027446 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000027446
Domain Number 1 Region: 567-623
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.62e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 2 Region: 342-399
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.75e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.73e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 454-511
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.6e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 174-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 6 Region: 398-455
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 7 Region: 230-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.95e-22
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 510-567
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-22
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 9 Region: 1-43
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 8.11e-18
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 10 Region: 137-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000593
Family Classic zinc finger, C2H2 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000027446   Gene: ENSMODG00000022829   Transcript: ENSMODT00000028987
Sequence length 642
Comment pep:novel chromosome:BROADO5:Un:9539982:9550733:-1 gene:ENSMODG00000022829 transcript:ENSMODT00000028987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVTFQDVAVDFTQEEWRLLDPGQKELYKEVMVENAQNVFSLGKDDVPWSPDLVCPLSLKR
TKRQVSLYSHPYSECPAYVFGCMCICPHLCFSMFPSDGERRLEMREPNAKLREESQQPGF
MNDNCCDFSLREILLQTYECNNCEMTFNLKSELIRHEKSHAGELLYIHNEKNQTFTQKPH
LVKHQRIHSGEKLYGCNQCGKTFRCNSELLQHQRIHTGEKPYACKQCGKTFRQRGSLKAH
HRIHTGEKPYECHQCGRSFRMKCILSAHQRIHTGEKPYKCHQCGKTFRQSCTLTDHQKIH
TGEKSHECNQCGKRFSRSSNLVIHQRIHTGEKPYQCNQCGKTFISKTDLLNHQRIHTGEK
PYECNHCGKSFRQRFNLVVHERTHTGEKPYECNQCGKTFPRPDRLAQHQRIHTGEKPYEC
NQCGKTFRQYFSFAEHKKIHTGEKPYACNQCGKAFRSNSDLRKHQRIHTGEKPYACKQCG
KTFTRSGNLASHQGIHTGEKSYECDNCGKAFRRNSDLLVHQTIHTEKKCYECNQCGNAFR
IKYQLARHQRIHTGEKPYECDDCGKYFTGKSQLVVHQRIHTGEKPYECDDCGKSFTWKSQ
LVIHQRIHTGEKPYACDNCGKAFRKNSDLLVHQRIHSGEEHT
Download sequence
Identical sequences H9H9G6
13616.ENSMODP00000027446 ENSMODP00000027446 ENSMODP00000027446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]