SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000028095 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000028095
Domain Number 1 Region: 263-320
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-26
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 660-717
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.75e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 716-773
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.44e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 5 Region: 381-437
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 6 Region: 208-264
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-23
Family Classic zinc finger, C2H2 0.0082
Further Details:      
 
Domain Number 8 Region: 604-661
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.35e-23
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 9 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 10 Region: 319-381
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.94e-22
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 11 Region: 152-208
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 12 Region: 1-53
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.68e-21
Family KRAB domain (Kruppel-associated box) 0.0013
Further Details:      
 
Domain Number 13 Region: 758-810
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.25e-20
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 14 Region: 92-149
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.9e-16
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 15 Region: 62-106
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000257
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000028095   Gene: ENSMODG00000013304   Transcript: ENSMODT00000029673
Sequence length 811
Comment pep:novel chromosome:BROADO5:1:712423844:712502816:1 gene:ENSMODG00000013304 transcript:ENSMODT00000029673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDVAVEFTQEEWGLLEPAQKDLFREVMLENYENFVSLGLPVSKPDVTCHLERRETFRPPE
EEKAFSPKGNLFSHKRIHSGEKPYKYNGYGKVFSNNQKLAPHPRIHTEEKYHNYNECDNI
FMQSSSLMQHQTIYTEGKPFTCNQCGKIFSIFINNRNLSRHQRIHSGEKPYKCNECGKAF
CTTSRLDVHKVIHPGERLFECNECGKGFRFRSAFMKHLRSHTGEKPYECNECGKAFSWKG
NLNTHKRIHTGEKPYLCNECGKAFSNNESLTRHQRIHTGERPYKCNECGKSFRQSSSLMQ
HHRIHTGEKPYKCNECGKAFNNSQNLTRHQRIHTGERPFELKPFKCNECGKAFSSKSYLI
QHKKIHTGVKPFKCNECGKGFMSKSYLIQHQRIHAGGKPYKCNECGKAFSSNSYLIQHQR
IHTGEKLYKCNECGKTFISNKQLSQHKRIHTGEKPYSCNECGKTFRQMGHVETHKKIHTG
EKPFECSECGKAFISNQQLSRHQRIHIGGKPYKCNECGKAFSSNSYLTLHQRIHPGGKPY
KCNECGKVFISNNNLIQHQKIHPGENPYKCNECGKVFSSNSYLIQHQRIHTGEKPYKCNE
CGKAFICNSYLIQHQRIHTGGKAYTCNECGKAFSSHQKLTLHQRIHTGEKPYKCSTCGKA
FNSNSYLIEHQRIHTGEKPYKCKECGKAFRQSSSLMQHQKIHTGEKPYHCNECGKAFRQS
SSLMQHQVIHTGEKPYKCNECGKAFNNNQNLSRHQRTHTGEKPYKCNKCGKAFSSNSYLT
QHQRIHTGEKPYKCNACWKSFSSNQKLSRHQ
Download sequence
Identical sequences F7BQJ5
ENSMODP00000028095 ENSMODP00000028095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]