SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029511 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029511
Domain Number 1 Region: 223-298
Classification Level Classification E-value
Superfamily GAS2 domain-like 3.92e-26
Family GAS2 domain 0.00017
Further Details:      
 
Domain Number 2 Region: 22-177
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.45e-25
Family Calponin-homology domain, CH-domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029511   Gene: ENSMODG00000008732   Transcript: ENSMODT00000031085
Sequence length 747
Comment pep:novel chromosome:BROADO5:3:517874260:517880333:1 gene:ENSMODG00000008732 transcript:ENSMODT00000031085 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKETSNIQCSASKSIRPFRSSEEYLDAMKEDLAEWLNALYGLAVPGGGGGFLEALETG
AVLCRHANNVNGIARDFEGARPEAAARLRLPAREVVFQAHGVAPGSFLARDNVSNFIAWC
RGELGIPDVLMFETDDLVLRKNEKNFVLCLLEVARRGSKFGVLAPMLIQLEEEIEEELRD
QAQQPGPPTAAGDPDKDRQPDPASGMGACPGRGPRMTLCDLRNLDELVREILGRCTCPDQ
FPMIKVSEGKYRVGDSSALIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCASVSHRLP
QPRALAFSPQKVPPVPSPRASSPGAQRWPDAGGSGPGGERRGSRTEGLPARLGAGGTGSP
QASAGPRAHRDGPDTRQSSAHRPPRSRRCSGDSDSSASSAQSGVLGCCRAEEGSPGPRKD
GSSQRGARVPAALRRPPAPRSESRDRGPGPSPRGEERGRPRGAHGARDARPTAPSPARRA
RSQGREDQPLLIRRDPDGQHSMARAGGSGRSTPRAGSPAPPRPRPQPPSAPEPPRPVRAV
DTLSQELEELARTFRAPLQLDPKQEQQLYRRLEEEFLANSKALEAERAALAQAPPSAPEP
AAPDSAYCSSSSSSSSLSFFSKPGAPGGGPAPNGVPAVPNGSGETWDARAAARRRAPALS
SSSDETAQGVGSGDDEGGPGRPSPAADPPRPRARPRADNQPARKPSRIPTPRAPQRPCQP
HAALAGFPEPLARVPRAESGREGGAWM
Download sequence
Identical sequences F6V8X2
ENSMODP00000029511 ENSMODP00000029511 13616.ENSMODP00000029511

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]