SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000029677 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000029677
Domain Number 1 Region: 405-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.02e-27
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 2 Region: 153-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.13e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 3 Region: 69-126
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.03e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 293-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-25
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 5 Region: 349-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-25
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 6 Region: 447-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.36e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 237-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 8 Region: 3-55
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.63e-21
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 9 Region: 200-232
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000768
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 116-148
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000031
Family Classic zinc finger, C2H2 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000029677   Gene: ENSMODG00000018865   Transcript: ENSMODT00000031251
Sequence length 510
Comment pep:novel chromosome:BROADO5:4:413695345:413697291:1 gene:ENSMODG00000018865 transcript:ENSMODT00000031251 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GEKPFKCDDCGKAFNQNSQLLKHQRIHTGEKPFKCNDCGKTFNQNFNLSVHQRIHTGEKP
FKCDDCRKAFNQSSHLLQHQRIHTGEKPFKCHDCGKAFIRSSTLLQHQRIHTDEKPFKCD
DCGKAFYQNSHLLKHHRIHTGEKPFKCNDCGKTFNQSSHLLQHQRIHIGEKPFKCNDCGK
AFSQRSKLIIHQRIHTGEKPFKCNDCGKAFNQSSHLLQHQRIHTGEKPFQCHGTGTSFNQ
NSNISVQQRIHTSERAFQCNDCEKAFNQSSHLLQHQRVHTGEKPFKCNDCGKVFSHRSKL
IIHQRIHTGEKPFKCHDCGKAFIRSSSLLQHQRIHTDEKPFKCDDCGKAFNHDSNLFQHQ
RIHTGEKPFKCDDCGKAFNQNSHLLQHQRIHTGEKPFQCHDCGKAFNQRSHLLQHQRIHT
GEKPFKCNDCGKAFSQSSHLLQHQRVHTGEKPFKCNDCGKAFSQRSKLIIHQRIHTGEKP
FKCNDCGKAFNQSSNLIVHQRIHTGKVIKK
Download sequence
Identical sequences F6X2L3
ENSMODP00000029677 ENSMODP00000029675 13616.ENSMODP00000029675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]