SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030396 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030396
Domain Number 1 Region: 17-137
Classification Level Classification E-value
Superfamily POZ domain 5.57e-22
Family BTB/POZ domain 0.0032
Further Details:      
 
Domain Number 2 Region: 307-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000414
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 345-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000121
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000030396
Domain Number - Region: 283-318
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0345
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030396   Gene: ENSMODG00000023552   Transcript: ENSMODT00000031968
Sequence length 452
Comment pep:novel chromosome:BROADO5:1:416816337:416817695:-1 gene:ENSMODG00000023552 transcript:ENSMODT00000031968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISTFPPFRSATMSERSDLLRFKFENYGDSMLQKMNKLREENKFCDVAVHIDDIEVQGHKI
VFAAGSPFLRDQFLLNDSREIKISILQSSEVGRQLLLSCYSGILEFPEMELVNYLTAASF
LQMSHIVERCTQALWKFIKPKQPLEGKEECEQQSDSSESKEQQVDDRDSQEQDSPCIQPS
EDSMDMEDSDIQIVKVESIGEVSEVRNKKDQNQFISSEPTALHSSEPQHSLINSTVENRV
NEIEQNHLHNYALSYAGSDNIIMASKDLFGPNNRGVDKGLQWHHQCPKCTRVFRHLENYA
NHLKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFSQKCSLQDHLNLHS
GDKPHKCNYCDMVFAHKPVLRKHLKQLHGKNSFDNANERNVQDLTVDFDSFACTTVTETK
GCQQPPDASQVLDAGKLAQAVLTIRSDGTCVN
Download sequence
Identical sequences F7BQV5
13616.ENSMODP00000030396 ENSMODP00000030396 ENSMODP00000030396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]