SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030427 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030427
Domain Number 1 Region: 455-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-25
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 679-736
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.56e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 567-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 623-680
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 5 Region: 791-848
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.78e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 399-456
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.18e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 8 Region: 153-213
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 9 Region: 735-792
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-21
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 10 Region: 361-413
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 11 Region: 837-889
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.38e-19
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 12 Region: 11-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.13e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 13 Region: 58-108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000111
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030427   Gene: ENSMODG00000023559   Transcript: ENSMODT00000031999
Sequence length 892
Comment pep:novel chromosome:BROADO5:4:401589993:401776270:-1 gene:ENSMODG00000023559 transcript:ENSMODT00000031999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSIGNEGGKTFPQNSKLAGHQRIHTGEKPYECNLCGKTFTKSSSLTKHKGIHNKKGPHE
FKECGKVLKEKDNLAEHQRIHTEEKHFDYKHCGKAFTDVSNLIEHKKIYTGEHGMQRESF
STLSILLPVEHQSLALGETLEPERMMPETQRPPCQESVTFQDVTVDFTQEEWCMLDHYQK
KLCREVMLENVQNLLSVGLPVPRENLISSCQQEESPWLLEQKGTRSLCPDAETSFEVKEI
TTKPSLVVKRSGKQGFMNADPYDLILRESYESNIKVNKNPNSDSEFYGIAKKFTQYSMLN
QNKKMTSGNEYHQNNEYNKYFPEKELLQSYMKPPEIFIYQDYPEEMAFTWSSSLIKHPKK
KPYECKHCGKAFTQRGNLAEHQRIHTGEKPYECKHCGKAFTQRGNLAEHQRIHIGEKPYD
CKECGKSFTLNSQLAKHQRIHTGTKPYECKQCGKAFTWRNGLVVHQRIHTGEKPYACKQC
GKAFTASYSLSIHQRIHTGEKPYECKQCGKTFTQSSGLTEHYRIHTGEKPYGCKQCGKSF
TTSYGLGAHRRIHTGEKPYECKQCGKAFTQRGNLAEHQRIHTGEKPYDCKECGKSFTLNS
QLAKHQRIHTGTKPYECKQCGKAFTWRNSLAVHQRIHTGEKPYACKQCGKAFTASYSLVG
HQRIHTREKPYECKECGKAFTQRGYLAIHQRIHTGERPYECKQCGKTFTQSSGLTEHHRI
HTGEKPYECKQCGKAFTTSYGLATHHRIHTGEKPYNCKDCEKSFTFSSQLATHQRIHTGM
KPYECKQCRKSFTFSSQLVSHQRIHSGEKPYECKQCGKAFTTRYSLAIHQKIHAGEKPYN
CKECGKSFTFTSQLATHQRIHTGTKPYECKQCGKAFTRRDGLAVHQRIHTGE
Download sequence
Identical sequences F7GL09
ENSMODP00000030427 ENSMODP00000030427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]