SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030438 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030438
Domain Number 1 Region: 442-499
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.1e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 386-443
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.74e-25
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 3 Region: 666-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-24
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 4 Region: 330-387
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 554-611
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.47e-24
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 498-555
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.47e-23
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 7 Region: 610-667
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.49e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 8 Region: 153-214
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.31e-22
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 9 Region: 712-764
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 10 Region: 11-66
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.16e-18
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 11 Region: 58-108
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000011
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 300-344
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000767
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030438   Gene: ENSMODG00000023561   Transcript: ENSMODT00000032010
Sequence length 767
Comment pep:novel chromosome:BROADO5:4:401798564:401814030:-1 gene:ENSMODG00000023561 transcript:ENSMODT00000032010 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHSIGNKGGKTFPQNSKLAGHQRIHTGEKPYECYLCGKTFTKSSSLTKHKGIHNKKGPHE
FKECGKVLKEKDNLAEHQRIHTEEKHFDYQHCGKAFTDVSNLIEHKKIYTGEHGMQRESF
STLSILLPEEHQSLALGEALEPERMTPDTQRPPSQESVTFQDVTVDFTQEEWCMLNHSQK
KLYREVMLENVQNLLSVGLPVPRENLISSCQQGESPWLLEHKGTRSFCPNAETSFEVKEM
TTKLNLVMKGSSKQGVMNEDPYDFILRESYESDIKVNKNPNSDNPKSNPGEKLSVSSKDG
KAFCQNSERARDQMIHTGEKLYECKECEKAFTRKDHLVQHQRIHTGEKPYECKQCGKTFT
QRACLSKHHRIHTGEKPYECKQCGKAFTQRGNLAAHQRIHTGEKPYDCKECGKSFTLNSQ
LAKHQRIHTGTKPYECKQCGKAFTWRNGLAVHQRIHTGEKPYVCKQCGKAFTASYSLSIH
QRIHTGEKPYECKQCGKTFTQSSGLTEHHRIHTGEKPYECKQCGKFFTTSYGLAKHQRIH
TGEKLYNCKECGKSFTFSSQLATHQRIHTGMKPYECKQCRKSFTFSSQLASHQRIHTGEK
PYECKQCGKAFKTRYNLAVHHRIHAGEKPYHCKECGKSFTFSSQLATHQRIHTGAKPYEC
KQCGKAFTRRDGLTVHQRIHTGEKPYECKQCRKSFTFSSQLATHQRIHTGEKPYECKQCG
KTFTTRDGLTVHQRIHTGEKPYECKQCGKTFTTSGHLAKHQRMHTGE
Download sequence
Identical sequences F7GKS9
ENSMODP00000030438 ENSMODP00000030438

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]