SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000030831 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000030831
Domain Number 1 Region: 278-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.16e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.7e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-25
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.2e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 222-279
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 449-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.12e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 166-223
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.56e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 8 Region: 390-445
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.33e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 9 Region: 110-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 10 Region: 600-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.39e-19
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 11 Region: 57-111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000156
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000030831   Gene: ENSMODG00000023639   Transcript: ENSMODT00000032402
Sequence length 653
Comment pep:novel chromosome:BROADO5:3:502608828:502617610:-1 gene:ENSMODG00000023639 transcript:ENSMODT00000032402 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLEQEGLRIWYPEGENRPEIMVNPTEVSFPVEEVNLQRSISDGPDNFASREFSVTSQNSS
YIEHQRMHPEEKSSENNQCGKSFLHRASLSGHQRIHTGEEIYEYKQCGKTFIVSPSLPRH
RSMHTGEKPHECQQCGKAFIRSSSLVEHQRMHTGEKPYECKQCGKAFSQRSHLPKHQRKH
TGEKPDECKQCGKAFSDSSHLATHQRMHTGEKPYECKQCGKAFSDSSHLATHQRKHTGEK
PYECKQCGKAFRTSSHLATHQRTHTGEKPHDCKQCGKAFSQRSILLQHQRIHTGEKPYVC
KQCGKAFSQRSTLVQHQRMHTGEKPYECKQCGKAFSCSSALAAHQRIHTGEKPYECQQCG
KAFSHRSYFATHQRTHTGEKPYDCKQCGKAFRNSSHLGRHQRTHSGEKPYECKQCGKAFS
DSFHLATHQRMHSGEKPYECKQCGKACQSSSHLAKHQRTHTGEKPYECKQCGKAFSDSSH
LATHQRKHTGEKPYECKQCGKAFSQRSTLVQHQRIHTGEKPYECKQCGKAFNHSSSILHH
QRIHTGVKPFECKQCGKAFSHRSYFATHQRTHTGEKPYDCKQCGKAFRQRSILLQHQRIH
TGEKPYECKQCGKAFRQRSHHARHQRIHTGEKPYEYNQGGKTFSWNSHLAVHQ
Download sequence
Identical sequences F7ED87
ENSMODP00000030831 ENSMODP00000030831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]