SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032379 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032379
Domain Number 1 Region: 2-114
Classification Level Classification E-value
Superfamily POZ domain 7.32e-25
Family BTB/POZ domain 0.0044
Further Details:      
 
Domain Number 2 Region: 931-989
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.8e-16
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 860-912
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000448
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 1007-1058
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000671
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 5 Region: 1103-1154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000157
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 6 Region: 836-869
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000046
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 7 Region: 762-814
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000707
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000032379
Domain Number - Region: 1077-1114
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00146
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 1160-1187
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00459
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032379   Gene: ENSMODG00000016092   Transcript: ENSMODT00000033960
Sequence length 1271
Comment pep:novel chromosome:BROADO5:4:355487476:355543219:-1 gene:ENSMODG00000016092 transcript:ENSMODT00000033960 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELPNYGRQLLQQLYTLCKENQFCDCTISIGTVYFRAHKLVLAAASLLFKTLLDNTDTIS
IDASVVSPDEFALLLEMMYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTSLVSCS
APSQVIREVSPQTVEPCQKDTDGLLVENTSPKNSIESLHPGESLSPVSLKADTVVVVSAV
TPDVGEVNSTMAQKELIMNSAIAHEEALEIEIHNAASPREPSDSSQMPSPPGQEAINEEE
EEEEEEEEKEKEKEKEVAVVAVSQNMTENTSELEHERKMYKLDFLLQNESIFSEAFSVAQ
DVLKRLDECREIKSPHKEVILECLEAEEGISAFQRILDKIRDNECLDVETVISLLELFQD
THPEIKAALQKRDSEDGENMQLKRSTEEGKTLSILLLEHKEDLIQSITQLRPIREFLETT
PQELLTSMEKEVILNCCKGGTPKETIENLLHQVTEEKTLTAESLVKLLQALKITFPNLDL
LLKNLQKQGSVPSTTVLPSPDDYGTELLRRYHENLSEIFTDDEMLLKVISSANSLTPGER
EAMEQLVKGDGSRGGFSPLVSAVLEGQALSGRAIWKVLLGAQTAESCPLNLLMEEMHKEP
GADYFFQAVATPESATIEIILRHSKLITEAIQPRAELKCFTPGEEKLAEAVKEILSVSCE
PASPEASLKAALSRAQEKSLPTMEICRLLCSIHEVFPGLQVVLQELGSLGLLTQEKEEGS
PERWKVLEGLEEVLAGSPAGPGEGIEKEKEEEELESSTTPSPKKNFVCTACDKSFHFYCR
LKVHVKRCRAAQGKQVPCRECGQMKASKKELEKHLQEAHAGTKALGTPKKKKRRLPVTCD
ICGREFAHASGMQYHKLTEHFDEKPFSCEECGAKFAANSTLKNHLRLHTGDRPFMCKHCL
MTFTQASALAYHTKKKHAEGKMYACQYCDAVFAQSIELSRHVRTHTGDKPYVCRECGKGF
RQANGLSIHLRTFHNIDDPYDCKKCRMSFPTLQDHRNHIHEVHSKEYHPCPTCGKIFSAP
SLLERHMVTHVGGKPFSCGVCDKAYQQLSGLWYHNRTHHPDVFAAQNHRSSKFTSLPCGS
CDKTFASTAAHKKHVKTEHADIKFHECETCQELFPTLALLQVHAKCRHSGSQPFRCLYCA
ASFRFPGALQHHVATEHFRQTENTFPCEVCGELFTSQAQLEGHFESEHGKVVVTEAQVTT
AATQMVQVIQAPEPGASAEQVITLEETPLAGSQVFVTLPDSQTPQASSELVAVTVEDLLD
GTVTLICGEAK
Download sequence
Identical sequences F7A531
ENSMODP00000032379 ENSMODP00000032379 XP_007491274.1.35504 XP_007491276.1.35504 XP_016277550.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]