SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032657 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032657
Domain Number 1 Region: 50-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000771
Family V set domains (antibody variable domain-like) 0.024
Further Details:      
 
Domain Number 2 Region: 275-365
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000531
Family I set domains 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032657   Gene: ENSMODG00000024031   Transcript: ENSMODT00000034236
Sequence length 419
Comment pep:novel chromosome:BROADO5:2:205097816:205099075:1 gene:ENSMODG00000024031 transcript:ENSMODT00000034236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLVHTPLLLLWAWGSFWAFEFVEKENIFQKTSCPAFLMFDNAAYLADMSFELPCHCKPE
EVSTVVWYYQKYIGSRHTRVLTDFDGRVVVDSGHIRVGSSMLARFSIQMFSLLVFRAQPE
DSGLYLCGTRQGNYFYGYDVDIQSSQNMLATFIDQGQKPPKDEKHGTLHIFTTFWEWTHC
DRCGVRGEQWRIGLCYLNKPGLSPRVRKTLPDVVSCGSQAVPKNIQNMAERHHPPELMIR
SCMVPCKKKKIQVGLMAIYTFISKKNRKPWIPKVPIQFHQQRLGHGLIISCPGARPEHAV
AWDKDNFRLYRTSFLKGVNWSMRVFIDHGNQLHIRFAQLNDRGIYYCWREGEMVAGFRLA
VTSWGPHHASLSDPETQYALKAALIGYLFLTAAFILIHLCRCCGDLFLLLLSIDFSLGP
Download sequence
Identical sequences F7D3V8
ENSMODP00000032657 ENSMODP00000032657 XP_007482524.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]