SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000032788 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000032788
Domain Number 1 Region: 1217-1372,1411-1490
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.61e-39
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1541-1791
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.41e-38
Family Voltage-gated potassium channels 0.014
Further Details:      
 
Domain Number 3 Region: 775-922,954-1001
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.02e-30
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Domain Number 4 Region: 137-275,375-444
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.73e-26
Family Voltage-gated potassium channels 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000032788   Gene: ENSMODG00000013404   Transcript: ENSMODT00000034368
Sequence length 2018
Comment pep:novel chromosome:BROADO5:6:288328244:288425466:-1 gene:ENSMODG00000013404 transcript:ENSMODT00000034368 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KMENLNGTLDTNHFRPFTPESLAAIEKRITEEKKEPGAENENLRPQLDLKACNQLPKFYG
ELPPELVGEPLEDLDPFYKNHRTFIVLNKGRTIFRFSATQALGLLSPFHPIRRVAIKLSV
HSYPFCWLVFSSKRSQVLFIMVTILVNCVFMTHRETPPVVEYVFTGIYTFESLLKILARG
FCLNEFTYLRDPWNWLDFGVIFLAYFAEITEFRGASALRTFRVFRALKTVSVIPGLKVIV
GALIHSVKKLADVMVLTVFCLSVFALVALQLFKGNLRHKCVKNCTLLNLSSDAYGENKTW
DFCRTDTGKSALHVKMPLGLSFTKVIHWCHIALGIDYYAHKNGTNEILLCGNSSEAGTCP
NGYFCIKTGNNPDYNYTSYDSFGWAFLALFRLMTQDYWERLYQQTLRASGKIYMLFFVLV
IFLGSFYLVNLILAVVTMAYEEQNEATMAEIEAKEKMFQETLERLRKEQELLGVPCLSVF
SLQVLAAMGIDTSSHLSFEMSPLASKNAKERRNRANQMKSDDSQEDGSSHHQRKMSIPLY
SSKRSLTRHASWLPSVPSERLLSWNLFCSPHLSLSGTLRGLVNFSPANGFAPSDTVRKKS
SQYGLDSVFTDDEKISGRENGSRRGSLLLAHMGQRMSTQNQRILSPQSLTPVARQDAKES
SNPGECNGKASLPGGDPASGNVTSSGATETSGKIDMKKNALTAHTLSAEYFDESFRVKRA
MSVVSIITSVLEELEESEQRCPPCWIRFAQKYLIWECWPPWVKFKNLVEYIVKDPFTELI
VTLCIVTNTLFMSMEHYNMTAAFSFMLQAGNIFFTFIFTAEMVFKIIAFHPYYYFQKSWN
IFDSVIVTLSLVELGLPQKASLSVLRSFRLLRVFKLAKSWPTLNNLIKIIGNSVGALGNL
TLILAIIVFIFAVVGKQLFGDNYDKLRDKNTQQLPRWHMHDFFHSFLVIFRILCGEWIET
MWDCMEVSGIPLCLIVFLMVMVLGNLVVLNLFIALLLNSFSADNLASEDDGDNNLQKALG
RIHKFMHFIAQTIRDFWGRSFWISKARKEKQKAVVKMAFSDSGALNHMTAQALPSTGSIK
DKPAPNGLALELASCPVDGPGNLVTNGVMEISVPMAVAESDLEDEEDEDEPSMALEAAPP
KQKGDVTSCSEGSTVDIPDPELILKQMTDLSEILEEPEDCFTEGCIRRYPCCDVDTGKSP
GSLCWNLRKTCYHIVEHNWFESFIIFMILLSSGALAFEDVNLEERATVKAILEFADRVFT
YIFILEMLLKWVAYGFQTYFTNAWCWLDFLIVDVSMISLIANTLGYSEIGPIKSLRTLRA
LRPLRALSRFEGMRVVVDALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFSGKFGRCINIT
LENFPPVDVLIVNNKTQCNEENGAGLFWDTVKVNFNNVGIGYLALLQVATFKGWMDIMYA
AVDSRKVKEQPEWEANLYMYLYFVIFIIFGGFFTLNLFVGVIIDNFNQQKKKISGQDIFM
TEEQKKYYNAMKKLGSKKPQKPIPRPLNKCQGFVFDIVTQQAFDIAIMVLICLNMITMMV
ETDSQSEVKTKILNRINHFFVAVFTAECVLKMFALRYYYFINGWNIFDFIVVILSIVSLV
FSGIMKSLENYFSPTLFRVIRLARIGRILRLIRAAKGIRTLLFALMMSLPALFNIGLLLF
LVMFIYSIFGMANFAYVKEEAGIDDMFNFRTFPNSMLCLFQITTSAGWDGLLSPILNTGY
PYCNPDSTNSSKPRGNCGNPTIGIAFFVSYIIISFLIVINMYIAVILENFNVATEESTEP
LSEDDFDMFYETWEKFDPEATQFISFSALSDFADTLTGPLRIPKPNQNELIQMDLPLVTG
DKIHCLDILFAFTKRVLGESGEMDTLKAQMEEKFMAANPSKDSYEPIATTLRSKQENVSA
SIIQRAYRKYLLQHSLRQVTVTCANDVGEPRCERATEDEGLAEFMMNESMELPDKSETAS
TMSFPPSYDSVTRGLSEEGQLDTSNTGHVEEDASYDQL
Download sequence
Identical sequences F7G6M8
13616.ENSMODP00000032788 ENSMODP00000032788 ENSMODP00000032788

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]