SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000034561 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000034561
Domain Number 1 Region: 346-448
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 3.35e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0017
Further Details:      
 
Domain Number 2 Region: 163-217,245-265
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.54e-16
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 
Domain Number 3 Region: 79-144
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 1.7e-16
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000034561   Gene: ENSMODG00000008708   Transcript: ENSMODT00000036149
Sequence length 602
Comment pep:novel chromosome:BROADO5:5:253645656:253728718:1 gene:ENSMODG00000008708 transcript:ENSMODT00000036149 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPTDLISSSLSATGMDCNRKRKGSSTDYQLDGFSFEESMDTD
KDDQHGRLEYPDQQGRIRNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLT
VLRMAVQHMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVS
ESVFKILNYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDIT
PGPSRLCSGARRSFFCRMKCNRPSVKVEEKDFPSTCSKKKADRKSFCTIHSTGYLKSWPP
TKMGLDEDNEPDNEGCNLSCLVAIGRLHSHVVPQPLNGEIRVKSTEYVSRHAIDGKFVFV
DQRATAILAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSF
ITLRSRWFSFMNPWTKEVEYIVSTNTVVSANVLESGDPTFPQLTASPHSMDSILPPGEGG
QKRNHPTVPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDAS
SPGGKKILNGGTPDIPSAGLLPGQIQDNPGYPYSDSSSILGENPHVGIYIVNMESRNPKL
VA
Download sequence
Identical sequences F7F1X5
ENSMODP00000034561 ENSMODP00000034561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]