SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000036128 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000036128
Domain Number 1 Region: 1043-1177,1236-1283
Classification Level Classification E-value
Superfamily Hemopexin-like domain 2.62e-38
Family Hemopexin-like domain 0.00075
Further Details:      
 
Domain Number 2 Region: 67-106
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000915
Family Somatomedin B domain 0.0014
Further Details:      
 
Domain Number 3 Region: 25-65
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000745
Family Somatomedin B domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000036128   Gene: ENSMODG00000011585   Transcript: ENSMODT00000037717
Sequence length 1297
Comment pep:novel chromosome:BROADO5:2:81804810:81835767:1 gene:ENSMODG00000011585 transcript:ENSMODT00000037717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKMLPVHLLVFFLFLIQVSSQDLPSCAGRCGEGYSRDAACNCDYNCQYYMECCPDYKK
VCTVELSCKGRCFESFARGRECDCDPDCKNYGKCCPDYEDFCEEIHNPATPRPPPKIQRP
SPEAPQTIKSTTKRSPKPPKKKTSNKVVESEEITEEHSVSENQESSSSSSSSSSSTVRKT
KSSKNSAANTTAKKKPKAKDSKKKRTPKEKPTPAPPVVDDTGSGVDNGPTVAPDIAVPPT
SKPNKVTTTPKTTAAPPPVTPKDSNKVTSKETATTTEKETSTAAKETSVVTKEMTSTDKQ
SSTTAKETTTSAKETLQTTETMTAAKDPKPTPEEAKPTPKDPKPTPEKPKPTPKDPKPTP
EEPKPTPKDPKPTPEEPKPTPKDPKPTPEEPKPTPKDPKPTPEEPKPTPKDPKPTPEEPK
PTPEEPKPTPKDPKPTPEEPKPTTDKPKPTPKDPKTTPEEPKPTPKDPKPTPEEPKPTPE
EPKPTPKDPKPTPEEPKTTTDKPKPTPKDPKPIPEEPKPTPKDPKPTTEEPKPTPEEPKP
TPKDPKPTTEEPKPTPEEPKPTPKDPKPTPEKPKPTPEEPKPTPKDPKPTPEEPKPTPKD
PKPTPGEPKPTPEEPKPTSKDPKPTPEDPEPTPKDPATSPKDTTSVPTTPEVTTVAKDKV
TENDKPTTPKITTATPKVISTTTKVTTRTVSSPKVTTKVTTTTAKATTTATKVTTTTAKE
TTSTAKETTATSNDKTTTPKATTPTPKKPTPKATPAPKVTSTTTKETTTTKETTAVPDET
TTPKMTPPTPKKPTPKATTTSTKVTTTTTKETTTTAKETTATSNDKTTTPKATTPTPKKP
TPKATPAPKVTSTTTKETTTTTKETTAVPDETTPALKETSKPKVTTPRPMKTTTTTKETT
TKDKETTVVTKDRTTPMVPTPVPKVTNKKTTPAPKKPVTTPKIITTSEEMTTLETSTLTE
LNPTAILQTTPGSNRRPNSETINSFAIPEVTPKNEGLNIFEQESYVNPRPPVFIPIGIPG
SSTYVGRPSQGISNVPMISDETNLCNGKPIDGLTTLRNGTLVAFRGHYFWMLNPFTPPSP
PRRITAVWGIPSPIDTVFTRCNCDGKTFFFKDSQYWRFTNDVRDPGYPKPIVKGFGGLNG
KIVAALSVAKYKNRPESVYFFKRGGTVQQYTYQQEPTKKCSARRPTMNYSVYGEPVQVRR
RRYERAIIPSQTHTIRINYLPVRVTYQKGFLHNEFKVNSVWRGLPSMITSAIALPNIRKP
DGYDYYAFSKDRYYNIDVPTRTANLITTRSGQTLSNV
Download sequence
Identical sequences F6X999
ENSMODP00000036128 ENSMODP00000036128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]