SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000037737 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000037737
Domain Number 1 Region: 6-290
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.26e-81
Family Protein kinases, catalytic subunit 0.000000000289
Further Details:      
 
Domain Number 2 Region: 369-663
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.94e-76
Family Ankyrin repeat 0.0000159
Further Details:      
 
Domain Number 3 Region: 1302-1390
Classification Level Classification E-value
Superfamily DEATH domain 7.95e-18
Family DEATH domain, DD 0.0052
Further Details:      
 
Domain Number 4 Region: 680-709,785-893
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000207
Family G proteins 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000037737   Gene: ENSMODG00000003480   Transcript: ENSMODT00000039342
Sequence length 1428
Comment pep:novel chromosome:BROADO5:6:16287880:16742983:1 gene:ENSMODG00000003480 transcript:ENSMODT00000039342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTVFRQENLDDYYDTGEELGSGQFAVVKKCREKSTGLQYAAKFIKKRRTKSSRRGVSRED
IEREVNILKEIQHPNVITLHDVYENKTDVILILELVAGGELFDFLAEKESLTEEEATEFL
KQILNGVYYLHSQHIAHFDLKPENIMLLDRNVPKPRIKIIDFGLAHKIDFGNEFKNIFGT
PEFVAPEIVNYEPLGLEADMWSIGVITYILLSGASPFLGDTKQETLANVSAVNYEFEEEF
FSNTSALAKDFIRRLLVKDPKKRMTIQDSLQHPWIKPKDSQQALSRKASAVNMEKFKKFA
ARKKWKQSVRLISLCQRLSRSFLSRSNMSVARSDDTLDEEDSFVMKAVIHAINDDNVPGL
QHLLGSLTNYDVNQPNKHGTPPLLIAAGCGNIQMLQLLIKRGARIDVQDKAGSNAIYWAS
RHGHVETLKFLNENKCPLDVKDKSGETALHVAARYGHVDVVQLLCSIGSNPNFQDKEEET
PLHCAAWHGYYSVAKALCEADCSVNIKNREGETPLLTASARGYHDIVECLAEHGADLDAT
DKDGHIALHLAVRRCQMEVIRTLISQGCFVDFQDRHGNTPLHVACKDGNVPIVVALCEAN
CLLDVTNKYGRTPLHLAANNGILEVVRYLCLTGANVEALTSDGKTAEDLARAEQHEHVAS
LLSRLRKDTHRALFIQQLRPTQNLQPRIKLKMFGHSGSGKTTLVESLKCGLIRSFFRRRR
PRLSSTNSTRFPPSPLSSKPTVSVSINNLYPGCENVSVRSRSMMFEPGLTKGMLEVFVSP
SHHSHCSADDQSTKAIDIQNAYLNGVGDFSVWEFSGNPVYFCCYDYFAANDPTSIHVVLF
SLEEPYEIQLNQVIFWLSFLKSLVPVEEPIAFGGRLKNPLRVVLVATHADIMNVPRPAGG
EFGYDKDMSLLKEIRNRFGNDLQISDKLFVLDAGASGSKDMKLLRNHLQDIRSQIVSVCP
PMTHLCEKIISTLPSWRKLNGPNQLMSLQQFVFDVQDQLNPLANEEDLRHIAQQLHSTGE
INIMQSETVQDVILLDPRWLCTNVLGKLLSVETPKALHHYRGRYTMEDIQRLVPESDVEE
LIQILDAMDICARDLSSGTMVDIPALIKTDNLHRSWTDEEDEVMIYGGVRIVPVEHLTPF
PCGIFHKVQVNLCRWIHQQSTEGDADIRLWVNGSKIAHRGAELLVLLVNHGQGIEVQVRG
LETEKIKCCLLLDSVCSTIENVMTTTLPGLLTVKHYLSPQQLREHHEPVMIYQPRDFFRA
QTLKETSLTNTMGGYKESFSSIMCFGCLDVYSQGSLGMDIHASDLNLLTRRKLSRLLDPP
DPMGKDWCLLAMNLGLPELVAKYNNGTHKDFLPSPVHALLQEWCHYPESTVGVLMSKLRE
LGRRDAADFLLRASSVFKINLDANGQEAYASSCNSGTSYNSISSVVSR
Download sequence
Identical sequences F7A0A5
ENSMODP00000037737 ENSMODP00000037737

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]