SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000038992 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000038992
Domain Number 1 Region: 129-242
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 4.94e-22
Family Retrovirus capsid protein, N-terminal core domain 0.0011
Further Details:      
 
Domain Number 2 Region: 377-407
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.000014
Family Retrovirus zinc finger-like domains 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000038992   Gene: ENSMODG00000028527   Transcript: ENSMODT00000042101
Sequence length 433
Comment pep:novel chromosome:BROADO5:2:85319195:85320562:1 gene:ENSMODG00000028527 transcript:ENSMODT00000042101 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAQLEDLKSFLQDQLANNHSTRNRPVSEPLNEEISFPEIEMENTFPIAQLTDCFSRVVQ
ILSEFNPQNPSPAIPVSLVPSPTENQIPMQGRSCPPRETCPCQTDPQVQNSTRVLFPLRE
VPEIGRNGDVVTLRHRIPFTPQEINEFTRNIPTYEQDPFLVTKKMGDIFFQYNPSYKDVE
SLLQALLSEREKNKIIAHVNKTRGRNAAHWPSQDPEWDYNNPEDYLQLYRCREAILTAMK
ECADSTDKWMELEKIKQNEDETPSRFMDRIIEFGDRYLDWDLTKESSLRQVRRIFVNNSC
KAIKNYFKTQCPRWSDMDLEELRKTAIYVLKGNKEKEEENNDDMEEMKKKMRCVIDRITK
LESGHDNEPTTIAPLQKSNYQSITCHFCGKKGHNMMDCRTFLKMFGRNTQFNNSFRNNNY
RNDDNGYRNQNSR
Download sequence
Identical sequences K7DZP1
ENSMODP00000038992 ENSMODP00000038992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]