SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039096 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039096
Domain Number 1 Region: 88-201
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 6.91e-22
Family Retrovirus capsid protein, N-terminal core domain 0.0012
Further Details:      
 
Domain Number 2 Region: 336-364
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0001
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039096   Gene: ENSMODG00000028802   Transcript: ENSMODT00000042206
Sequence length 369
Comment pep:novel chromosome:BROADO5:2:136414850:136416423:-1 gene:ENSMODG00000028802 transcript:ENSMODT00000042206 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENTFPIAQLTDCFSRVVQILSEFNPQNPSPAIPASHVPSPTENQIPMQGRSCPPRETCP
CQTDPQVQNSTRGLFPLREVPEIGQNGDVVTLRHRIPFTPQEINEFTRNIPTYEQDPFLV
TKKMGDIFFQYNPSYKDVESLLQAFLSEREKNKIIAHVNKTRGHNAAHWPSQDPEWDYNN
PEDYLQLYRCREAILTAMKECADSTDKWMDLEKIKQKEDETPSRFMDRIIEFGDRYLDWD
LTKENSLRQVRRIFVNNSCKVIKNYFKTQCPRWSDMDLEELRKTAIYVLKGNKEKEEENK
DDMEEMKKKIRYLIDRITKLESGHDNEPMTIAPLQKSNYQSITCHFCEKKGHKMMECRTF
LKMFGRNTQ
Download sequence
Identical sequences K7DZZ5
ENSMODP00000039096 ENSMODP00000039096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]