SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039400 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039400
Domain Number 1 Region: 88-201
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.33e-21
Family Retrovirus capsid protein, N-terminal core domain 0.0012
Further Details:      
 
Domain Number 2 Region: 336-365
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000858
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039400   Gene: ENSMODG00000027529   Transcript: ENSMODT00000043869
Sequence length 389
Comment pep:novel chromosome:BROADO5:5:148204757:148206041:1 gene:ENSMODG00000027529 transcript:ENSMODT00000043869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MENTFPIAQLTDCFSCVVQILSEFNPQNPSPAIPASHVPSPTENQIPMQGRSCPPRETCP
CQTDPQVQNSTRGLFPLREVPEIGRNGDVVTLRHRIPFTPQEINEFTRNIPTYEQDPFLV
TKKMGDIFFQYNPSYKDVESLLQAFLSEREKNKIIAHVNKTRGRNAAHWPSQDPEWDYNN
PEDYLQLYRCREAILTAMKECADSTDKWMELEKIKQKENETPSRFMDRIIEFGDRYLDWD
LNKENSLRQVRRIFVNNSCKVIKNYFKTQCPRWSDMDLEELRKTAIYVFKGNEEKEKENN
DDMEEMKKKMRCVIDRITKLESGHDNEPTTIAPLQKSNYQSITCHFCEKKGHKMMECRTF
LKMFGRNTQFNNGFRNNNYRNYDNGYRNQ
Download sequence
Identical sequences K7E0U9
ENSMODP00000039400 ENSMODP00000039400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]