SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000039764 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000039764
Domain Number 1 Region: 170-280
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 1.18e-19
Family Retrovirus capsid protein, N-terminal core domain 0.002
Further Details:      
 
Domain Number 2 Region: 415-453
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000195
Family Retrovirus zinc finger-like domains 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000039764
Domain Number - Region: 292-335
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0687
Family Retrovirus capsid protein C-terminal domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000039764   Gene: ENSMODG00000027849   Transcript: ENSMODT00000042869
Sequence length 533
Comment pep:novel chromosome:BROADO5:6:50904144:50905745:-1 gene:ENSMODG00000027849 transcript:ENSMODT00000042869 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMTVQNIVVVMGVLACLVQCFLICYNILFIDIPYMLYFIMNIYGNIKWLKMELDRVISYL
PVMIVLLYIMIKIYYSGKQIFFKILGKRAVGKNDNELRVLVLTMKETMEKMQLKLDKLTG
ETEASKNKVAEQKDNDTQPKPNEDQDIKEPNTAAASLLPLCDLTYIQPEAGINHVKTHKP
FNTSDLDHLRQRMPRYFDEPMKCVKEFKRAIKLYDPSFEDTELLLSELFTKQEKEQFVQE
TRNDPNLTSWPSDTQHLELSNIENLRFLGQARQSILEAMKIHAKKPDNWGKFEKLKQEPG
ENPSTFLDRVIEMAENLLGFVDLSEQNLEHIRRQFVKGSCLPVRNYFRLECPSWESMGLE
DLRKTAVYVFSGEKEKGSDDKDELVQELRNQLKEANRKLKEKEIEDVKTMETLKTSRPRQ
EYAPRKQRTNQMRCFLCNMPGHFLRECRFRSQLNNNYNNNSYSSNRNASGGWRQSRSTYQ
NYKQSNRQEQGQCCSHICNQSMSQAPNLGTMQEYIKAGARPKYSTIVSDDTKA
Download sequence
Identical sequences K7E1W3
ENSMODP00000039764 XP_007498187.1.35504 XP_016279329.1.35504 XP_016279330.1.35504 XP_016279331.1.35504 ENSMODP00000039764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]