SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040380 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040380
Domain Number 1 Region: 128-241
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 3.14e-21
Family Retrovirus capsid protein, N-terminal core domain 0.0013
Further Details:      
 
Domain Number 2 Region: 376-406
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0000858
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040380   Gene: ENSMODG00000028719   Transcript: ENSMODT00000043486
Sequence length 437
Comment pep:novel chromosome:BROADO5:4:106842333:106843751:-1 gene:ENSMODG00000028719 transcript:ENSMODT00000043486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAQLEDLKSLLQDQLANNHSTRNRPVSEPLNEEISFPEIEMENTFPIAQLTDCFSRVVQ
ILSEFNPQNPSPAIPASHVPSTENQIPMQGRSCPPRETCHCQTDPQVQNSTGGLFPLREV
PEIGRNGDVVTLRHRIPFTPQEINEFTRNIPTYEQDPFLVTKKMGDIFFQYNPSYKDVES
LLQAFLSEREKNKIIAHVNKTRGRNAAHWPSQDPEWDYNNPDDYLQLYRCREAILTAMKE
CADSTDKWMELEKIKQKEDETPSRFMDRIIEFGDRYLDWDLTKESSLRQVRRIFVNNSCK
AIKNYFKTQCPRWSDMDLEELRKTAIYVLKGNEEKEKENNDDMEEMKKKMRYLIDRITKL
ESGHDNEPTTIAPLQKSNYQSITCHFCEKKGHKMMECRTFLKMIGRNTQFNNSFRNNNYN
EYRNKNFRNQNYRNRNW
Download sequence
Identical sequences K7E3M8
ENSMODP00000040380 ENSMODP00000040380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]