SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040434 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040434
Domain Number 1 Region: 1-69
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000000000369
Family alpha-catenin/vinculin 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040434   Gene: ENSMODG00000028365   Transcript: ENSMODT00000043541
Sequence length 156
Comment pep:novel chromosome:BROADO5:1:29579706:29659620:1 gene:ENSMODG00000028365 transcript:ENSMODT00000043541 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLKSPAQRDEIAGARASLKENSPLLHSICSACLEHDDVASLQASKDTVCNEIQNALDMIS
NASQGIQSSKAEPEPHYQHQTDKILRYLNLVILDPLTVSEDKIRPSLEKRLEAIISGAAL
LADSSCTRDFHRERIITECNSIRQALQDLLSEYMDN
Download sequence
Identical sequences K7E3T2
ENSMODP00000040434 ENSMODP00000040434

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]