SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000040906 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000040906
Domain Number 1 Region: 147-260
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 7.22e-20
Family Retrovirus capsid protein, N-terminal core domain 0.0013
Further Details:      
 
Domain Number 2 Region: 395-425
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0001
Family Retrovirus zinc finger-like domains 0.0066
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000040906
Domain Number - Region: 270-328
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.0238
Family Retrovirus capsid protein C-terminal domain 0.014
Further Details:      
 
Domain Number - Region: 335-400
Classification Level Classification E-value
Superfamily Tropomyosin 0.0916
Family Tropomyosin 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000040906   Gene: ENSMODG00000027807   Transcript: ENSMODT00000044014
Sequence length 462
Comment pep:novel chromosome:BROADO5:2:261648710:261650098:-1 gene:ENSMODG00000027807 transcript:ENSMODT00000044014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDKIGNMEDKIGKIEDKMQAQLEDLKSFLQDQLANNHSTRNRPVSEPLNEEISFPEIEM
ENTFPIAQLTDCFSRAVQILTEFNPQNPSPAIPVSHVPSPTENQIPTQRRSCPPRETCPC
QTDPQVQNSTRGLFPLREVPEIGRNGDVVTLRYRIPFTPQEINEFTRNIPTYEQDPFLVT
KKMGDIFFQHNPSYKDFENLPQAFLSEREKNKIIAHVNKTRGRNAAHWPSQTPEWDYNNP
EDYLQLYHCREAILTAMKECADSTDKWMELEKIKQKEEESPSRFMDRIIEFGDRYLDWDL
TKESSLRQVKKIFVNNSCKAIKNYFRTQCPRWSYMDLEELRKTAIYVLKGNKEKEEENND
DMEEVKKKIRYLIDRMTKLESGHDNEPTTIAPLQKSNYQSITCHFCEKKGHKMMECRTFL
KMFGRNTQFNNSFRNNNYRNDDNGYRNQNSRNYNNDYVNNYK
Download sequence
Identical sequences K7E554
ENSMODP00000040906 ENSMODP00000040906

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]