SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000041150 from Monodelphis domestica 69_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000041150
Domain Number 1 Region: 84-174
Classification Level Classification E-value
Superfamily GTF2I-like repeat 1.29e-33
Family GTF2I-like repeat 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000041150   Gene: ENSMODG00000028169   Transcript: ENSMODT00000044260
Sequence length 203
Comment pep:novel chromosome:BROADO5:2:514300981:514325305:-1 gene:ENSMODG00000028169 transcript:ENSMODT00000044260 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLRADKRAPPTTRYHCSVSFHRLDKCSLAEDCEPGTSGELSGLRHIKIEPDDLDIIQVTV
PEKGPCEDLRHEEKQVEDGIGDVIRHLRKQVETLFNTRYAKAIGISEPVKVPYSKFLMYP
EELFVVGLPEGISLRRPNCFGIAKLRKILEASSSIHFVIKRPELLAEGIKETATDSPGTL
ERDSGDSLVDETVKRQGFQGKKG
Download sequence
Identical sequences K7E5U8
ENSMODP00000041150 ENSMODP00000041150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]