SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000005 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000005
Domain Number 1 Region: 56-375
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.42e-92
Family Protein kinases, catalytic subunit 0.0000000208
Further Details:      
 
Domain Number 2 Region: 25-35
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000732
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000005   Gene: ENSMODG00000000005   Transcript: ENSMODT00000000005
Sequence length 384
Comment pep:known_by_projection chromosome:BROADO5:7:45783445:45978844:1 gene:ENSMODG00000000005 transcript:ENSMODT00000000005 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAAGCAAKAAKVGAGNGGSEGNPPPPPPPPPPPPAPPGSSGSGDSEPAHSSSPAVGPGS
PAPSPELPAYKLQDFDTLATVGTGTFGRVHLVKERTAKHYFALKVMSIPDVIRLKQEQHV
HNEKSVLKEVSHPFLIRLYWTYHDERFLYMLMEYDPGEYLFSYVRDMGRFNNSTGLFYSA
EIICAIEYLHSKEIVYRDLKPENILLDKEGHIKLTDFGFAKKLLDRTWTLCGTPEYLAPE
VIQSKGHGRAVDWWALGILIFEMLSGFPPFFDDNPFGIYQKILAGKIDFPRHLDLYVKDL
IKKLLVVDRTRRLGNMKNGADDVKKHRWFRSVDWDAVPQRKLKPPIVPKVSNDGDTSNFE
AYPEDDWNKMPPVPPKDLEIFKNF
Download sequence
Identical sequences F6SJ42
ENSMODP00000000005 XP_007501027.1.35504 ENSMODP00000000005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]