SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000015 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000015
Domain Number 1 Region: 578-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.36e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 299-356
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 355-412
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-24
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 522-579
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.27e-23
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 49-109
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-23
Family KRAB domain (Kruppel-associated box) 0.00087
Further Details:      
 
Domain Number 6 Region: 411-468
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.79e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 7 Region: 634-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.5e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 8 Region: 484-536
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000112
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 269-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000012
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000015   Gene: ENSMODG00000023467   Transcript: ENSMODT00000000015
Sequence length 684
Comment pep:novel chromosome:BROADO5:3:521947571:521974030:1 gene:ENSMODG00000023467 transcript:ENSMODT00000000015 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAAAFLGPLLGAHRGSLRPSGLPPPEGPQGDPSREPAAREMAPRTPRPSQGSITFKDVA
VDFTQEEWCLLDHSQKELYLEVMLENVQNLLSVGLPVPRENFISCLQQGKAPWLLAQKDS
RNSCLEAKTNFEVKDLSAKLSLSLEGSGPQRCMSEDPHDFLLRHICDSTIKVNKNPKSDS
EFDETAEKFSQYSVLTRYMKFTSGNDYCLDSEYRKCFLKEVGLLQSPEKPEMPVYQGNVR
GITFGCISDVIRHRKSKCVKKVSVIDKGGRSFSKNCELTAHQRIHTIEKPYKCKQCGKAF
TRRGNLATHQRIHTGEKPYDCKHCGKAFTQSYNLFTHQRIHTGKKPYKCKQCGKTFRQRG
SLDTHQIIHTGEKPHKCKHCGKAFTLRGNLTVHQRIHSGEKPYECSQCGKAFTQKCSLAR
HQRIHAVEKSYECKRCGKAFTQRGNLATHQRIHTGEKPYECKQCGNAFIERDCLARNQSI
TAEKPYEFKQYRKAFTQTGSLAAHQRIHNGKKAYECKQCRKAFTLRVHLYRHQRIHTVEK
PYECKQCGKVFSRRGHLATHQRIHTGEKPYECKQCGKAFRLRGDLAAHQRIHTGEKPYEC
KQCGKAFKQRSSLATHQRIHTGEKPYECKHCGKAFTLRGNLAAHMRIHSGEKPYECNQCG
KAFTQKCSLAKHQRIHTVEKPYEC
Download sequence
Identical sequences F6SIG8
ENSMODP00000000015 ENSMODP00000000015

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]