SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000343 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000343
Domain Number 1 Region: 401-458
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-25
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 345-402
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.15e-25
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 3 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.81e-25
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 4 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.14e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 541-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.89e-23
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 289-346
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.16e-21
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 7 Region: 583-635
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 139-191
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.44e-20
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 9 Region: 3-51
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.68e-17
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 10 Region: 219-271
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000384
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 11 Region: 448-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000188
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000343   Gene: ENSMODG00000006321   Transcript: ENSMODT00000000350
Sequence length 645
Comment pep:known_by_projection chromosome:BROADO5:Un:55789330:55802580:-1 gene:ENSMODG00000006321 transcript:ENSMODT00000000350 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NLLFQGPVKFEDVAIYLWKEEWELMDSTQKRLYRQVMLETYENVLSKSFWHVTLFPTNAT
SEERGHEYKGILDLNLKMVPHSGNLSRERAQQCDSHKHSHRQNAVPLRYHLPNNEEKPSI
GGEAGSWPSGFDCRGRKSKVYKCDECGKTFGRKSCFIRHQRIHSGERPYECKECGKAFNQ
NSTLAKHQRIHTGEKPFECYECGKAFRRSSSLTRHWRVHTGEKPYKCKECGKMFGGRGNL
INHQRTHSEGKPCESRVCGKYFKGCSGFSKHQEIQSGEKTHEFKECGKAFIHHSNLSNHQ
RIHSVEKPYECEECGKAFTFRSGLSKHQRHHSGEKHYQCKECGKAFTFRSGLILHQRIHS
GEKPYECKQCGKSFIQSSDLSKHQRIHSGEKPYECKECGKTFRGSSGLIRHQRIHSGEKP
YECKECGKTFRRSSGLIRHQRIHSGEKPYECKQCGKAFIHSSVLSQHQRIHSGEKPYECK
QCGKAFTFSSGLSKHQRIHSGEKPYECKECGKTFTFRSDLRSHQRIHSGEKPYECKECGK
AFIHSSYLSKHQRIHTGVKPYECKECGKDFTFSSSLSKHRRIHSGDKPYECKECGKTFRG
SSGLIRHQRIHSGEKPYECKQCGKAFTFRSDFSQHHRIHSGEKPC
Download sequence
Identical sequences H9H5W0
ENSMODP00000000343 ENSMODP00000000343 13616.ENSMODP00000000343

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]