SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000344 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000344
Domain Number 1 Region: 151-179
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000962
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000344
Domain Number - Region: 188-212
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00964
Family Classic zinc finger, C2H2 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000344   Gene: ENSMODG00000000289   Transcript: ENSMODT00000000351
Sequence length 223
Comment pep:known_by_projection chromosome:BROADO5:8:296527814:296648319:1 gene:ENSMODG00000000289 transcript:ENSMODT00000000351 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVTGHFLKMEVLGATGQNTDPRVLEKQELQQPTYVALSYINRFMTDAARREQESLKKKI
QPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSSSFRSSTPTGSEYDEEEIDYE
ESDSDESWTTESAISSEAILSSMCMNGGDEKPFACPVPGCKKRYKNVNGIKYHAKNGHRT
QIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRKMQQ
Download sequence
Identical sequences F6WAV0
ENSMODP00000000344 XP_007505376.1.35504 ENSMODP00000000344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]