SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000370 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000370
Domain Number 1 Region: 964-1181
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.65e-45
Family BCR-homology GTPase activation domain (BH-domain) 0.00012
Further Details:      
 
Domain Number 2 Region: 830-950
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000376
Family PLC-like (P variant) 0.073
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000370
Domain Number - Region: 156-223
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0706
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000370   Gene: ENSMODG00000000311   Transcript: ENSMODT00000000377
Sequence length 1347
Comment pep:known_by_projection chromosome:BROADO5:2:42890995:42987805:1 gene:ENSMODG00000000311 transcript:ENSMODT00000000377 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEPLKRTWSRLRGKRAPRGVARPDRERARPAEPRVPLASLAPASPEGEDTGPATPCALS
PRGSGYGSSFGSPLSRRPSSGGRVLLVEESPDLEDEDYYENLPGPEGEGPVAPVAASAAS
SSAAGSSPGAGGGRLETGRLRSQLQEAYYLLIQAMHDLQQVSPPQAPWTGLEGHRHPAAA
PPPPSPPPSPPPSAPPLLSSPPPLFPSLPPPSPPLPPPPPSPLPLSPLPRMRLLCGRSLE
SFPICGPSPLRRWSSDSAVPSSAPLATPPSSCAGRDGDAPEPRGGTMDSPGPGCASLAGP
AGCMGLLPSKRGNGTALIRNSGSSVSPFSDPAAPSGLHRSKGDVPEGPFFKPPVVTVKKL
QKWMYKGRLLSLGMKGRVSGSPAPKVLDTQAAPQCLGALKMQESKTHPVPPDQRIMLSDL
IENVYMSSMKKRELKGLKDNELNEQRSHNRITVSKKRNWLHQSTLKSPNLEEESKKTQEV
THLFKSPSLSQHHRPKPVHKATNSSTSRNYALEFSEENDADDEGEIWYNPIPEDDGHILY
SVASSGEPNSVNLGISTLTLKVSSGNDLAKTVRHVENLPFSPEHVNVQIAQPTEINQVDS
MYSAEFIQLKKQRFGFRTQDSSLVEESPPLKSITGPGIPIATSKSELSTSESSPPSPNPA
KKGGSINWSFPDKIKSPKTVRKLSMKMKKLPELSRKLSVKGTLGHIHSSHGPSSLSKCNC
PGRSHIITLPSGNTIPAAQRNVISRYHLDSSVSSQHSFPKENSSSSKSTCKGGYLSDGDS
PELIIKSGKRGSENKHLRGKEVFPNSSNKTEIDIDAFRHYSFSDQPKCSQYLSGLMSVHF
YGAEDLKPPRMDSKDVFCAIQVDSVNKARTALLTCRTTFLDMDHTFNIEIENAQHLKLVV
FSWEPTPRRNRVCCHGTVVLPTLFRVTKTHQLAVKLEPRGLIYVKVTLMEQWENSLPGLD
ANQEPVIFGVDVQKVVEKENVGLMVPLLMQKCIMEIEKRGCQVVGLYRLCGSAAVKKELR
EAFEKDSKAVGLCENQYPDINVITGVLKDYLRELPSPLITKQLYEAVLDAMAKNPLKMTG
NGCENDPNDSKHTVELLDCLPDIEKATLKMLLDHLKLVASYHEVNKMTCQNLAVCFGPVL
LSQRQETSPHNHRVFTDSKELASALDFKKHIEVLHYLLQLWPVQRLNVKEPPGDWFPEQK
SLNCLRRKKQRPHMLNLSVPEGSGVLRPRQARLDSPLSNRYAGDWSGCGENYFVNPKENV
NEVDYDDVPSEDTESGEDCSKGDGPDTGAQQPKPISKECPFQTYLAMQAIDSSVDRTVNL
KDLQESIDILIGNLERELNKNKLNISV
Download sequence
Identical sequences F6VV52
ENSMODP00000000370 XP_007480657.1.35504 ENSMODP00000000370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]